All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D)

Code
MSDS
MSDS
Size Pls inquire
Source
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
LY6G6D
Uniprot NO.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
20-104aa
Target Protein Sequence
LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Mol. Weight
12kD
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Description

Related Products

See all products about LY6G6D>>

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Gene References into Functions
  1. Frequencies of the DRB1, DQA1, DQB1 and TNFA alleles in immigrant population of West Siberia PMID:19807019

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.
Tissue Specificity
Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Database Links

HGNC: 13935

UNIGENE: Hs.591792

KEGG: hsa:58530

STRING: 9606.ENSP00000364985

OMIM: 606038

Promotions
Reward For Reviews
Free trial size antibodies
Contact Us

  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
LY6G6D (LY6-G): A New Member of Lymphocyte Antigen-6 Family Holds Big Opportunities in Bispecific Antibody for CRC Treatment!CUSABIO's Five Expression SystemsHow to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchApproaches to Determinate Protein ConcentrationExploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing ItWhat Is Protein Characterization: Definition, Examples, Methods, and TechniquesProtein Tags: A Comprehensive Overview
Related pathways
Target Therapy
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
support@cusabio.com
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy