Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

CSB-EP013246HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-B2M-JD-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
LY6G6D
Uniprot NO.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
10-104aa
Target Protein Sequence
LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Mol. Weight
15.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-B2M-JD-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Gene References into Functions
  1. Frequencies of the DRB1, DQA1, DQB1 and TNFA alleles in immigrant population of West Siberia PMID:19807019

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.
Tissue Specificity
Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Database Links

HGNC: 13935

UNIGENE: Hs.591792

KEGG: hsa:58530

STRING: 9606.ENSP00000364985

OMIM: 606038

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products