The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the yeast of the human TPO protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the yeast cells for expression. Following purification, the product is the recombinant human TPO protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant TPO protein up to 90%. It had an apparent molecular weight of approximately 40 kDa. This recombinant TPO protein may be used in the research of TPO-related cancer.
TPO is a gene providing instructions for making a protein named thyroid peroxidase (abbreviated TPO) in human and belongs to peroxidase family and XPO subfamily. TPO is an enzyme normally found in the thyroid gland, plays an important role in the production of thyroid hormones. TPO is found in thyroid follicle cells where it converts the thyroid hormone T4 to T3. In clinic, the presence of TPO antibodies in your blood suggests that the cause of thyroid disease is an autoimmune disorder, such as Hashimoto's disease or Graves' disease.
We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP024112HU His
FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
Email: support@cusabio.com
Distributors Worldwide