Recombinant Human Thyroid peroxidase (TPO), partial, Escherichia Coli

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TPO
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-161aa
Target Protein Sequence
FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSAAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9kD
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
Gene References into Functions
  1. genetic association studies in population in Japan: Data suggest that SNPs in TPO (rs2071400 C/T, rs2071403 A/G) are associated with development of Hashimoto's disease and Graves' disease, but not with the prognosis of individual patients in the population studied. PMID:28845025
  2. Biochemical properties of the TPO protein expressed in cancer and normal breast tissue are similar to those observed for the thyroid TPO. Nevertheless, there are some differences in comparison with the thyroid-tissue expressed protein, such as a lower N-glycan content, a slightly smaller polypeptide length, a decreased enzymatic activity, and undetectable dimer formation. PMID:29513734
  3. For the first time, we have isolated thyroid peroxidase by immunocytochemistry in the granulosa cumulus cells of the human ovarian follicle, thereby supporting the hypothesis that the human ovarian follicle may be an independent thyroid-hormone producing unit. PMID:28277109
  4. study to examine the relationship between the Asn698Thr (A2095C) and Thr725Pro (A2173C) polymorphisms of the TPO gene and anti-TPO levels in patients with subclinical hypothyroidism; ncreased anti-TPO antibodies were significantly associated with the A2173C polymorphism PMID:28500830
  5. Low expression of TPO is associated with dilated cardiomyopathy and impaired left ventricular function accompanied by increased risk of death. PMID:29320567
  6. Our findings suggest that variants inside or near TPO, ATXN2 and RASGRP1 genes are associated with HT. Identified loci are novel to HT and represent good basis for further exploration of HT susceptibility. PMID:27268232
  7. Our study indicated that the prevalence of TPO mutations was 1% among studied Chinese patients with CH. A novel TPO variation c.1682C>T/p. T561M was found, thereby expanding the mutational spectrum of the gene. PMID:27173810
  8. It is concluded that TPO 2173A>C polymorphism may be considered as a risk factor for developing autoimmune thyroiditis in patients with allergic rhinitis and asthma and that these patients should regularly be checked for hidden thyroiditis. PMID:28502155
  9. TPO transcripts were present in both normal and breast cancer tissue samples, although the amounts in the latter were reduced. TPO levels are lower in more advanced cancers. PMID:28575127
  10. Biallelic TPO mutations most commonly underlie severe congenital hypothyroidism. PMID:27525530
  11. The results of the study suggest that rs11675434 SNP located near TPO is associated with the development of Graves ophthalmopathy, especially in males and patients with later age of the disease onset. PMID:27829681
  12. Mutations in the TPO gene are associated with Congenital hypothyroidism and thyroid dyshormonogenesis. PMID:26894573
  13. Compound heterozygous mutations in the TPO gene are associated with congenital hypothyroidism. PMID:27135621
  14. Studies suggest that Thyroid Peroxidase autoantibodies in early to mid-pregnancy is associated with concurrent depression and may be predictive of depression in the postpartum period. PMID:27011366
  15. a homozygous nonsense mutation (R540X) in two patients with congenital hypothyroidism; the strong genotype/phenotype correlation associated with this mutation PMID:26777044
  16. Anti-thyroid peroxidase (TPO) antibodies and male gender were significantly associated with glucose impairment in patients with beta thalassemia major. PMID:27123460
  17. Lower pretreatment serum CXCL10 levels are associated with thyroid dysfunction. Thyroid dysfunction prevalence increases in female patients and patients who are positive for TPOAb at baseline. PMID:26361424
  18. This is the first description of a TD causing mutation in Tunisia and thus may help to develop a genetic screening protocol for congenital hypothyroidism in the studied region. PMID:25968604
  19. Two novel inactivating mutations (c.1970T> C and c.2665G> T) in the TPO gene cause congenital hypothyroidism. PMID:26174974
  20. function and autoantigenicity of TPO PMID:26623656
  21. This study confirms the pathogenicity of Y55X mutation in two patients with congenital hypothyroidism and demonstrates that a nonsense mutation in the amino-terminal coding region of the TPO gene could totally abolish the function of the TPO enzyme leading to total iodide organification defect. PMID:25328990
  22. analysis of thyroid peroxidase autoantibody levels in type 1 diabetes in discordant twin pairs PMID:26070305
  23. Data show that thyroperoxidase (TPO) single nucleotide polymorphisms (SNPs) rs4927611 TT and rs732609 CC are genotypes associated with potential risk for the congenital hypothyroidism (CH). PMID:26663066
  24. A single base deletion in the carboxyl-terminal coding region of the TPO gene could cause congenital hypothyroidism and helps to establish a genotype/phenotype correlation associated with the mutation. PMID:25241611
  25. Molecular cloning and functional studies of wild type and mutant forms harboring missense mutations in TPO gene showed decreased activity in the three mutants, higher Km values and lower reaction efficiencies (Vmax/Km). PMID:25576858
  26. The effects of inhibition of the TPO/c-MPL pathway on enhancing the chemotherapy sensitivity of AML cells. PMID:24085601
  27. The detection of the novel c.670_672del and c.1186C>T alterations expand the mutation spectrum of TPO associated with thyroid dyshormonogenesis. PMID:25564141
  28. The vWA and TPOX microsatellites are good candidate biomarkers in venous thromboembolism diseases and could help to elucidate their origins. PMID:25250329
  29. Variable clinical phenotypes in a family with homozygous c.1159G>A mutation in the thyroid peroxidase gene. PMID:24717978
  30. In conclusion, the c.2268dup mutation leads to the formation of normal and alternatively spliced TPO mRNA transcripts with a consequential loss of TPO enzymatic activity in Malaysian-Chinese patients with goitrous CH. PMID:24745015
  31. The results provide insight into why individuals with thyroid autoimmunity do or do not eventually develop thyroid disease, and these markers may therefore predict which TPOAb-positives are particularly at risk of developing clinical thyroid dysfunction. PMID:24586183
  32. The study suggested the possibility of TPO gene polymorphisms as a possible pathogenetic mechanism of hypothyroidism. PMID:24420335
  33. presented two children with CH who were born to consanguineous parents and were homozygous carriers of a missense (G319R) TPO mutation, the mutation segregated with the disease status in the families confirming its pathogenicity PMID:24158420
  34. There was shown an association of polymorphic variants of the gene DIO2 (274A > G) with elevated levels of antibodies to TPO and TPO gene (2173A > C) with elevated levels of free T4. PMID:25306702
  35. Our results point to a redundant role for the propeptide sequence in TPO. It is expressed in a membrane-anchored, enzymatically active form that is insensitive to intramolecular proteolysis, and importantly is recognized by patients' autoantibodies PMID:23668778
  36. One fourth of type 1 diabetes mellitus pregnant women presented with positive anti-TPO antibodies. However, the presence of anti-TPO antibodies does not seem to be related with worse metabolic control or adverse pregnancy outcome. PMID:23985426
  37. 21 TPO mutations in 28 thyroid dyshormonogenesis cases were identified showing potential linkage to this locus PMID:23236987
  38. Congenital goitrous primary hypothyroidism in two German families caused by novel thyroid peroxidase (TPO) gene mutations PMID:23512414
  39. TPO as a gene involved in the risk of differentiated thyroid carcinoma (DTC). PMID:23754668
  40. congenital goitrous hypothyroidism of the Chinese siblings was due to the TPO gene mutations (c.2268-2269 insT and c.2089 G>A) PMID:23329183
  41. Data indicate that the association between miscarriage and increased anti-thyroid peroxidase antibodies (TPOAb) levels. PMID:23672306
  42. Positive anti-TPO antibody in asthmatic patients may show presence of a hidden autoimmune thyroiditis in these patients. PMID:22947910
  43. In a consanguineous Pakistani family with intellectual disability, Homozygosity mapping located the causative defect on chromosome 2p25.3-p25.2. Targeted next-generation sequencing revealed an intragenic deletion of 5 exons of TPO. PMID:22387573
  44. analysis of how minimally invasive follicular thyroid carcinoma developed in dyshormonogenetic multinodular goiter due to thyroid peroxidase gene mutation [case report] PMID:22435912
  45. the correlation between TPOab and diagnostic parameters among newly diagnosed breast cancer patients PMID:22149743
  46. Findings confirm the genetic heterogeneity of TPO defects and the importance of the implementation of molecular studies to determinate the aetiology of the CH with dyshormonogenesis. PMID:21981063
  47. Data suggest that in Hashimoto's thyroiditis, both antigens, TPO and thyroglobulin, are recognized by peripheral and thyroid gland infiltrating CD8-positive T-cells and are involved in thyroid destruction leading to clinical disease manifestation. PMID:22259066
  48. The study identified underlying TSHR and TPO mutations in Korean patients with congenital hypothyroidism and revealed a possible relationship between imaging findings and mutation status. PMID:21707688
  49. In the presence of the C allele of T1936C, Anti-TPO level was significantly increased. PMID:22326521
  50. A high frequency of mutation in the TPO gene was detected in patients with congenital hypothyroidism. PMID:22093430

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface.
Protein Families
Peroxidase family, XPO subfamily
Database Links

HGNC: 12015

UNIGENE: Hs.467554

KEGG: hsa:7173

STRING: 9606.ENSP00000318820

OMIM: 274500

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1