Abbreviation
Recombinant Human TNF protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 30-150 pg/ml.
Alternative Names
APC1; APC1 protein; Cachectin; DIF; Differentiation inducing factor; Macrophage cytotoxic factor; Tnf; TNF superfamily member 2; TNF superfamily, member 2; TNF, macrophage derived; TNF, monocyte derived; TNF-a; TNF-alpha; TNFA; TNFA_HUMAN; TNFSF2; Tumor necrosis factor (TNF superfamily member 2); Tumor necrosis factor alpha; Tumor necrosis factor; Tumor necrosis factor ligand superfamily member 2; Tumor Necrosis Factor, Membrane Form; Tumor necrosis factor, soluble form
Species
Homo sapiens (Human)
Expression Region
57-233aa
Target Protein Sequence
GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 100mM NaCl, pH 8.0.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
TNF-α drives NF-κB and MAPK signaling cascades central to inflammation, apoptosis, and tumor microenvironment remodeling, making precise recombinant preparations essential for mechanistic studies. This recombinant human TNF-α encompasses the mature extracellular domain (aa 57–233) expressed in *E. coli* with an N-terminal 6xHis tag, and demonstrates potent cytotoxicity against L-929 fibroblasts with an ED50 of 30–150 pg/mL in the presence of actinomycin D—confirming signaling-competent homotrimer formation. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts, which supports use in immune cell activation assays, TNF-α-induced apoptosis studies, NF-κB reporter assays, and in vivo tumor biology models where confounding innate immune stimulation must be excluded. Purity exceeding 95% by SDS-PAGE, combined with this low endotoxin burden, also provides a suitable basis for antibody development workflows and as a reference standard in TNF-α detection ELISAs.
