KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Gene References into Functions
These findings support the view that SCF, in addition to its pro-proliferative effects, is important for the differentiation of MCs.PMID:27619074
In vitro, SCF induced the phosphorylation of p38 MAPK and cofilin, leading to the migration of cardiac stem cells.PMID:28986094
MAPK3/1 participates in primordial follicle activation through mTORC1-KITL signaling.PMID:28218391
MicroRNA-205 maintains T cell development following stress by regulating Foxn1 and its two regulated targets, stem cell factor and ccl25, following stress.PMID:27646003
Bone marrow adipocytes synthesize SCF, promoting hematopoietic stem cell proliferation/regeneration.PMID:28714970
SCF/c-kit signaling may potentiate chronic hypoxia-induced vascular remodeling by modulating ERK activation. Inhibition of c-kit activity may be a potential strategy to alleviate PHPMID:26705118
Kit ligand regulates the subcellular localization of FOXO3 in the neonatal mouse ovary.PMID:26507072
The results of this study indicate that c-kit/KITL signalling also occurs in the human ovary, as established in various animal models, and may involve previously unknown autocrine signallingPMID:26008799
Streptozotocin-induced diabetes was induced in cKit-mutant mice with low cKit expression in their endothelial cells.PMID:26978025
study suggests extracellular HMGB1 participates in NLRP3 inflammasome activity and regulates IL-1beta associated sterile inflammation induced by MWCNTPMID:25779020
These results show that mast cell deficiency, in the absence of Kit mutations, plays no role in the regulation of weight gain or insulin resistance.PMID:25955205
Stem cell factor is essential for preserving reconstitution capacity of ex vivo expanded cord blood CD34(+) cells in Immunocompromised mice.PMID:25899394
High stem cell factor expression is associated with breast cancer metastasis.PMID:23577751
Cardiomyocyte-specific overexpression of hSCF promotes epicardial activation and myocardial arteriogenesis post MI.PMID:25107671
SCF+G-CSF treatment in chronic stroke remodels neural circuits in the aged brainPMID:23750212
Data reveal that SCF disrupts the endothelial adherens junction and enhances vascular leakage, and suggest that anti-SCF/cKit therapy may hold promise as a potential therapy for the treatment of hyperpermeable vascular diseases.PMID:24790137
results show that the c-kit/mSCF/MMP-9 axis regulates IL-23 gene expression in DCs to control IL-17 production in the lung.PMID:24829419
Data indicate that insulin-like growth factor-1 (IGF1) stimulated s tem cell factor (Kitl/KITLG) protein and mRNA expression and promoter activity by activating several signaling pathways.PMID:24116170
Wnt7a triggers melanocyte stem cell differentiation through beta-catenin activation, and Kitl might induce following migration of melanoblasts to epidermisPMID:23702581
data and the identification of c-kit/Kit-ligand clusters at cell contacts suggest that membrane-bound Kit ligand captures cell surface-expressed c-kitPMID:22637532
A major role is described for SCF in the homeostatic control of mast cell activation with potential relevance to mast cell-driven disease and the development of novel approaches for the treatment of allergic disorders.PMID:22529299
Proliferation and the basal/luminal cell composition of cells isolated from the proximal region of prostatic ducts (the stem cell niche) is regulated in part by opposing effects of stem cell factor and endogenous TGF-beta.PMID:22024978
Data show tumor-promoting potential of mast cells could be augmented by molecules released from damaged tumor cells through cooperative stimulation of stem cell factor (SCF) and ligand for Toll-like receptor 4 (TLR4).PMID:21877248
membrane-bound Steel factor controls germ cell motility within a "motility niche" that moves through the embryo with the germ cellsPMID:21998739
These experiments revealed a new function of stem cell factor in chemokine receptor coupling.PMID:20427772
The altered sorting of KitL is dispensable for hematopoietic and melanogenic lineages, yet is crucial in the testicular environment, where the basal membranes of adjacent polarized Sertoli cells form a niche for the proliferating spermatogonia.PMID:19874813
Results suggest that the c2j tyrosinase defect can be rescued in part by stem cell factor in the ears and tail.PMID:19682281
diabetic mice show a decline in the number of interstitial cells of Cajal and impairment in the ultrastructures, and these abnormalities are attributed to a deficiency in the endogenous SCF but are not related to hyperglycemiaPMID:19875700
cell surface form of SCF mainly promotes the proliferation of hemopoietic stem cellsPMID:11811778
data show that Kitl induces telomerase activity in mitotic spermatogonia and increases the mRNA levels of both the catalytic subunit form and the telomerase RNA templatePMID:11950883
intracellular signaling pathway of SCF/KIT-mediated cell migrationPMID:11964302
role of fibronectin and stem cell factor in melanocyte growth, differentiation and migrationPMID:12028583
involvement of Kit/SCF at different stages of spermatogenesisPMID:12080001
involved in the induction of LTP and the blockade of LTP by rmSCF might be due to an occlusion of SCF/c-kit signalingPMID:12137920
different isoforms of SCF may use different biochemical pathways in stimulation of survival and/or proliferation of erythroid cellsPMID:12149209
Stem cell factor radioprotection is due to PLC gamma 1-dependent negative regulation of ionizing radiation induced neutral sphingomyelinase stimulationPMID:12149210
stem cell factor (kit ligand) stimulated neurogenesis in vitro and in vivoPMID:12163450
identification of an allelic series of mutations in the kit ligand genePMID:12242244
effects of ethylnitrosourea-induced Kitl point mutations on survival and peripheral blood cells of Kitl(Steel) micePMID:12242245
SCF is a potent eosinophil degranulator and activator that may play a number of roles during an inflammatory/immune response.PMID:12453875
Levels of E2A protein expression in B cell precursors are stage-dependent and inhibited by stem cell factor, mainly from posttranscriptional regulation.PMID:12482503
data suggest that FoxO3 plays an important role in kit ligand-mediated survival of hematopoietic progenitorsPMID:12691919
Phosphatidylinositol 3-kinase is essential for kit ligand-mediated survival.PMID:12960281
Stem cell plays a significant role in restoring hepatocyte proliferation in IL-6 knockout mice following hepatectomy.PMID:14597766
that although transmembrane-SCF does not appear to play a role in the homing of transplanted cells to the bone marrow, it is critical in the lodgment and detainment of HSC within their hemopoietic "niche."PMID:14662336
SLF and SDF-1alpha have a synergistic effect in fetal hematopoietic stem cellsPMID:15024423
XPA (-/-), SCF-Tg mice did not develop skin cancers after repeated exposures to UVB for 30 wk at a total dose of 72 J per cm(2)PMID:15191564
C-terminal valine defines a specific endoplasmic reticulum export signal in KitlPMID:15475566
Cessation of SCF treatment results in the rapid reduction of cutaneous skin mast cell populations by apoptosis.PMID:15502858
role for SCF in cell migration and survival in the developing cortex; SCF is a survival factor, but not a mitogen or a differentiation factor for neural stem cellsPMID:15530856
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.