Abbreviation
Recombinant Mouse Kitlg protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit(CSB-MP012375MO). The EC50 is 15.57-20.95 ng/mL.
②The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL.
Alternative Names
Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor (MGF); Steel factor; Stem cell factor (SCF); c-Kit ligand; Soluble KIT ligand (sKITLG); KitlgKitl, Mgf, Sl, Slf
Species
Mus musculus (Mouse)
Expression Region
26-189aa
Target Protein Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit(CSB-MP012375MO). The EC50 is 15.57-20.95 ng/mL.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL.
Description
Kit ligand plays a central role in hematopoiesis and mast cell development by activating the c-Kit receptor tyrosine kinase, making it essential for studies of stem cell maintenance, lineage commitment, and immune cell maturation. This recombinant mouse protein, spanning residues 26–189, demonstrates an ED50 of 1.691–11.94 ng/mL in TF-1 cell proliferation assays, providing quantitative evidence that it supports dose-dependent functional studies of hematopoietic progenitor expansion and mast cell growth. Receptor-binding validation by functional ELISA confirms specific interaction with mouse c-Kit (EC50 15.57–20.95 ng/mL), enabling its use in signaling pathway investigations—including JAK/STAT and MAPK activation studies—as well as in antibody development workflows where confirmed receptor engagement is critical. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for primary immune cell assays, where LPS contamination would confound cytokine-specific responses.
