Abbreviation
Recombinant Mouse Kitlg protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of TF-1 cells is 4-12 ng/ml.
Alternative Names
Kitlg; Kitl; Mgf; Sl; Slf; Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; c-Kit ligand
Species
Mus musculus (Mouse)
Expression Region
26-189aa
Target Protein Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
Kit ligand (SCF) drives c-Kit receptor signaling critical for hematopoiesis, mast cell development, and melanogenesis, making validated recombinant forms essential for dissecting these pathways. This tag-free mouse Kitlg (aa 26–189) demonstrates robust signaling potency with an ED50 of 4–12 ng/ml in TF-1 cell proliferation assays, confirming its suitability for dose-response studies, hematopoietic progenitor expansion, and JAK/STAT or MAPK pathway activation experiments. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive immune cell assays, supporting reliable use in mast cell differentiation protocols, in vivo murine models of hematopoietic reconstitution, and as a reference standard in SCF detection assays. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, aligns with standards expected in antibody validation workflows including ELISA coating and functional blocking studies.
