Abbreviation
Recombinant Mouse Kitlg protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit (CSB-MP012375MO1) at 2 μg/mL can bind Mouse Kitlg. The EC50 is 19.35-24.80 ng/mL. ②Recombinant Mouse Kitlg captured on Protein A Chip can bind Recombinant Mouse Kit (CSB-MP012375MO1) with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; c-Kit ligand [Cleaved into: Soluble KIT ligand; sKITLG]
Species
Mus musculus (Mouse)
Expression Region
26-189aa
Target Protein Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit (CSB-MP012375MO1) at 2 μg/ml can bind Mouse Kitlg. The EC50 is 19.35-24.80 ng/mL.
-
Activity
Recombinant Mouse Kitlg captured on Protein A Chip can bind Recombinant Mouse Kit (CSB-MP012375MO1) with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Kit ligand orchestrates hematopoietic stem cell maintenance and mast cell development through high-affinity engagement of the c-Kit receptor, making quantitative receptor-binding data essential for interpreting dose-response experiments. This mammalian-expressed protein, spanning residues 26–189 and carrying a C-terminal hFc1 tag, binds immobilized mouse c-Kit with an EC50 of 19.35–24.80 ng/mL in functional ELISA and exhibits a KD of 15.1 nM by surface plasmon resonance, providing a validated basis for cell proliferation assays with Kit-dependent lines such as mast cell progenitors or hematopoietic cell models. Endotoxin levels below 1.0 EU/μg meet the stringent thresholds required for primary immune cell cultures, where LPS contamination would confound cytokine-driven signaling through JAK/STAT or MAPK pathways. Purity exceeding 95% by SDS-PAGE supports its use as a coating antigen in antibody development workflows and as a positive control in Kit ligand detection assays.
