Recombinant Human Fibroblast growth factor 7 (FGF7)

Code: CSB-MP008634HU
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human FGF7 protein
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
FGF7
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Heparin-binding growth factor 7;Keratinocyte growth factor
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
32-194aa
Target Protein Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.15.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Gene References into Functions
  1. Low KGF expression is associated with epithelial ovarian cancer cell proliferation and invasion. PMID:29970688
  2. Findings suggest that excessive KGF and KGFR synthesis may contribute to the hyperproliferative state in cholesteatoma and could explain the pathological difference between cholesteatoma and CSOM. PMID:29556625
  3. Results suggest that fibroblast growth factor 7 may stimulate endometrial stromal cells proliferation and insulin-like growth factor-binding protein 1 and prolactin expressions through ERK and JNK signal pathways in an autocrine manner. PMID:28270036
  4. The stability and activity of rhKGF mutants were analyzed using GROMACS molecular dynamics (MD) simulations and docking tools, respectively. The results showed that N159S (N105S in rhKGF sequence) and I172V (I118V in rhKGF) substitutions caused an increased stability and affinity of the rhKGF to Fibroblast growth factor receptor 2 (FGFR2). PMID:28093295
  5. Tregs isolated from human lung tissue can be stimulated ex vivo to induce kgf expression. PMID:28296468
  6. FGF7 stimulation of cell invasion and migration was partially suppressed by the FGFR2 knockdown. In addition, FGF7/FGFR2 upregulated THBS1, and cell invasion and migration were decreased by knockdown of THBS1 PMID:28339036
  7. Suppression of miR-219-5p may benefit the liver regeneration and prevent cirrhosis through increasing KGF. PMID:27855391
  8. This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells. PMID:26514676
  9. KGF expression induced epithelial cell proliferation, reaching a peak level at day 4 and then decreased later, while in the long-term model, KGF expression in the EAC led to middle ear cholesteatoma formation PMID:25138153
  10. In the current study, conditioned media and chemically defined media with recombinant human keratinocyte growth factor (KGF) could induce hUC-MSC differentiation into sweat gland-like cells (SGCs). PMID:26574554
  11. Coexpression of KGF and MMP-9 in gastric cancer could be a useful prognostic factor, and MMP-9 might also serve as a novel target for both prognostic prediction and therapeutics. PMID:26350198
  12. FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma PMID:25623741
  13. Data indicate the key roles played, on the melanosome transfer in normal skin, by KGF/FGF7 released by dermal fibroblasts and by its receptor KGFR/FGFR2b expressed and activated on the epidermal keratinocytes. PMID:25313018
  14. First evidence of a role of FGF7 in the regulation of sequential steps of the autophagic process and strengthen the hypothesis of a direct interplay between autophagy and differentiation. PMID:24577098
  15. An SNP in FGF7 is associated with an increased risk of chronic obstructive pulmonary disease. PMID:22796760
  16. These findings indicate that topically delivered KGF-1 DNA plasmid can increase epithelial thickness and strength, demonstrating the potential of this approach to restore compromised skin. PMID:24434934
  17. Recombinant keratinocyte growth factor 1 in tobacco potentially promotes wound healing in diabetic rats. PMID:24783215
  18. Sustained effect of KGF on cell survival and proliferation could be attributed to its ability to inhibit p53, retinoblastoma, caspases, and p27(kip) functions in apoptosis and cell cycle arrest. PMID:24426773
  19. FGF7 stimulates osteogenic differentiation, but not proliferation, in embryonic stem cells, by activating ERK/Runx2 signaling. PMID:24026476
  20. This paper provides an overview of the knowledge on molecular properties, biological functions and the ecent findings on clinical application of EGF7. [review] PMID:24188496
  21. High FGF7 expression is associated with ameloblastoma. PMID:24002438
  22. IL-19 is important for cutaneous wound healing because it upregulates KGF expression. PMID:23582717
  23. FGF7 supports hematopoietic stem and progenitor cells and leukemia-initiating cells indirectly via FGFR2IIIb expressed on stromal cells. PMID:24051090
  24. The aim of this study was to determine whether the K-sam gene and keratinocyte growth factor (KGF) expression may be used to identify malignant tumors with a poor prognosis. PMID:23545898
  25. KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system. PMID:23554911
  26. The LTA downstream segment alternate core promoter was active only after specific cellular stimulation and was the major promoter used when human T cells were stimulated with TGF-beta1 and fibroblast growth factor-7. PMID:23547113
  27. Increased KGF expression promotes fibroblast activation in a double paracrine manner resulting in cutaneous fibrosis. PMID:23096718
  28. results implicate pericryptal myofibroblast-derived paracrine KGF and largely autocrine amphiregulin in the upregulation of claudin-2 in Caco-2 epithelial monolayers and consequent disruption of tight junction integrity PMID:22946653
  29. Keratinocyte growth factor up-regulates Interleukin-7 expression following intestinal ischemia/reperfusion in vitro and in vivo. PMID:22949940
  30. the activation of the stromal fibroblasts present in the pathological tissue, and the consequent increased secretion of KGF, play a crucial role in the deregulation of the epidermal proliferation and differentiation. PMID:22481617
  31. these data suggest that FGF7 is a novel regulator of CYP7A1 expression in hepatocytes and may prevent hepatocytes from accumulating toxic bile acids during liver injury and fibrosis. PMID:22713451
  32. Repression of Ink4a in aged (ETPs) Early T-cell progenitors results in their partial rejuvenation and this can be accomplished by in vivo fibroblast growth factor 7 administration. PMID:22555975
  33. In COPD, SNPs (rs12591300 and rs4480740) were significantly associated with COPD in an independent population (combined p values of 7.9E-7 and 2.8E-6). Increased lung tissue FGF7 expression was associated with worse measures of lung function. PMID:21921092
  34. FGF7 enhanced keratinocyte proliferation and its expression was increased when NCTC 2544 cells were subjected to treatments with plantaricin A preparations or hyaluronic acid. PMID:21782870
  35. Carcinoma-associated fibroblasts promotes the proliferation of a lingual carcinoma cell line by secreting keratinocyte growth factor. PMID:21340484
  36. KGF may have a role in ameliorating radiation-induced pulmonary injury in rats PMID:21436609
  37. These results suggest that the growth factors HGF and KGF may play a role in enhancing IL-1-stimulated production of IL-8 by epithelial cells during mucosal inflammations. PMID:21082280
  38. KGF increases pigment production and deposition in melanocytes in vitro and in vivo PMID:19780816
  39. The upregulation of KGF/KGFR might induce the formation of rete ridges and hyperpigmentation in solar lentigines. PMID:20620021
  40. Modulation of calprotectin in human keratinocytes by keratinocyte growth factor and interleukin-1alpha. PMID:20065999
  41. the expression of keratinocyte growth factor (KGF) and keratinocyte growth factor receptor (KGFR) in Hela cells PMID:17593825
  42. KGF and KGFR are both expressed in CaSki cells. Autocrine and recombinant human KGF affect cell proliferation and migration. PMID:17953372
  43. keratinocyte growth factor works via an inducible lentivirus to protect bone marrow cells against bleomycin-induced pulmonary fibrosis PMID:19956603
  44. The goal of this study was to elucidate the control mechanisms by which exogenous proteins regulate keratinocyte growth factor (KGF) expression in fibroblasts adhered to differing substrates. PMID:20036421
  45. The effect of KGF on limbal epithelial cell growth is mediated by upregulation of DeltaNp63alpha through the p38 pathway. PMID:19920075
  46. KGF induced proliferation but did not cause significant differentiation of 3 hematopoietic cell lines and bone marrow cells transduced with human K-sam. PMID:11937263
  47. play important roles in lung development, lung inflammation, and repair. PMID:11943656
  48. keratinocyte growth factor (KGF), a key stimulator of epithelial cell proliferation during wound healing, preferentially binds to collagens I, III, and VI. PMID:11973338
  49. KGF may hold promise for the treatment of very premature neonates with bronchopulmonary dysplasia. PMID:12016100
  50. Following activation by KGF binding, KGF and the KGF receptor remain associated in active complexes through the endocytic pathway, which is described. PMID:12122441

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Epithelial cell.
Database Links

HGNC: 3685

UNIGENE: Hs.567268

KEGG: hsa:2252

STRING: 9606.ENSP00000267843

OMIM: 148180

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products