CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris,1mM EDTA,5% Trehalose, 0.02% Tween 80, pH 8.0.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Gene References into Functions
Low KGF expression is associated with epithelial ovarian cancer cell proliferation and invasion.PMID:29970688
Findings suggest that excessive KGF and KGFR synthesis may contribute to the hyperproliferative state in cholesteatoma and could explain the pathological difference between cholesteatoma and CSOM.PMID:29556625
Results suggest that fibroblast growth factor 7 may stimulate endometrial stromal cells proliferation and insulin-like growth factor-binding protein 1 and prolactin expressions through ERK and JNK signal pathways in an autocrine manner.PMID:28270036
The stability and activity of rhKGF mutants were analyzed using GROMACS molecular dynamics (MD) simulations and docking tools, respectively. The results showed that N159S (N105S in rhKGF sequence) and I172V (I118V in rhKGF) substitutions caused an increased stability and affinity of the rhKGF to Fibroblast growth factor receptor 2 (FGFR2).PMID:28093295
Tregs isolated from human lung tissue can be stimulated ex vivo to induce kgf expression.PMID:28296468
FGF7 stimulation of cell invasion and migration was partially suppressed by the FGFR2 knockdown. In addition, FGF7/FGFR2 upregulated THBS1, and cell invasion and migration were decreased by knockdown of THBS1PMID:28339036
Suppression of miR-219-5p may benefit the liver regeneration and prevent cirrhosis through increasing KGF.PMID:27855391
This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells.PMID:26514676
KGF expression induced epithelial cell proliferation, reaching a peak level at day 4 and then decreased later, while in the long-term model, KGF expression in the EAC led to middle ear cholesteatoma formationPMID:25138153
In the current study, conditioned media and chemically defined media with recombinant human keratinocyte growth factor (KGF) could induce hUC-MSC differentiation into sweat gland-like cells (SGCs).PMID:26574554
Coexpression of KGF and MMP-9 in gastric cancer could be a useful prognostic factor, and MMP-9 might also serve as a novel target for both prognostic prediction and therapeutics.PMID:26350198
FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinomaPMID:25623741
Data indicate the key roles played, on the melanosome transfer in normal skin, by KGF/FGF7 released by dermal fibroblasts and by its receptor KGFR/FGFR2b expressed and activated on the epidermal keratinocytes.PMID:25313018
First evidence of a role of FGF7 in the regulation of sequential steps of the autophagic process and strengthen the hypothesis of a direct interplay between autophagy and differentiation.PMID:24577098
An SNP in FGF7 is associated with an increased risk of chronic obstructive pulmonary disease.PMID:22796760
These findings indicate that topically delivered KGF-1 DNA plasmid can increase epithelial thickness and strength, demonstrating the potential of this approach to restore compromised skin.PMID:24434934
Recombinant keratinocyte growth factor 1 in tobacco potentially promotes wound healing in diabetic rats.PMID:24783215
Sustained effect of KGF on cell survival and proliferation could be attributed to its ability to inhibit p53, retinoblastoma, caspases, and p27(kip) functions in apoptosis and cell cycle arrest.PMID:24426773
FGF7 stimulates osteogenic differentiation, but not proliferation, in embryonic stem cells, by activating ERK/Runx2 signaling.PMID:24026476
This paper provides an overview of the knowledge on molecular properties, biological functions and the ecent findings on clinical application of EGF7. [review]PMID:24188496
High FGF7 expression is associated with ameloblastoma.PMID:24002438
IL-19 is important for cutaneous wound healing because it upregulates KGF expression.PMID:23582717
FGF7 supports hematopoietic stem and progenitor cells and leukemia-initiating cells indirectly via FGFR2IIIb expressed on stromal cells.PMID:24051090
The aim of this study was to determine whether the K-sam gene and keratinocyte growth factor (KGF) expression may be used to identify malignant tumors with a poor prognosis.PMID:23545898
KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system.PMID:23554911
The LTA downstream segment alternate core promoter was active only after specific cellular stimulation and was the major promoter used when human T cells were stimulated with TGF-beta1 and fibroblast growth factor-7.PMID:23547113
Increased KGF expression promotes fibroblast activation in a double paracrine manner resulting in cutaneous fibrosis.PMID:23096718
results implicate pericryptal myofibroblast-derived paracrine KGF and largely autocrine amphiregulin in the upregulation of claudin-2 in Caco-2 epithelial monolayers and consequent disruption of tight junction integrityPMID:22946653
Keratinocyte growth factor up-regulates Interleukin-7 expression following intestinal ischemia/reperfusion in vitro and in vivo.PMID:22949940
the activation of the stromal fibroblasts present in the pathological tissue, and the consequent increased secretion of KGF, play a crucial role in the deregulation of the epidermal proliferation and differentiation.PMID:22481617
these data suggest that FGF7 is a novel regulator of CYP7A1 expression in hepatocytes and may prevent hepatocytes from accumulating toxic bile acids during liver injury and fibrosis.PMID:22713451
Repression of Ink4a in aged (ETPs) Early T-cell progenitors results in their partial rejuvenation and this can be accomplished by in vivo fibroblast growth factor 7 administration.PMID:22555975
In COPD, SNPs (rs12591300 and rs4480740) were significantly associated with COPD in an independent population (combined p values of 7.9E-7 and 2.8E-6). Increased lung tissue FGF7 expression was associated with worse measures of lung function.PMID:21921092
FGF7 enhanced keratinocyte proliferation and its expression was increased when NCTC 2544 cells were subjected to treatments with plantaricin A preparations or hyaluronic acid.PMID:21782870
Carcinoma-associated fibroblasts promotes the proliferation of a lingual carcinoma cell line by secreting keratinocyte growth factor.PMID:21340484
KGF may have a role in ameliorating radiation-induced pulmonary injury in ratsPMID:21436609
These results suggest that the growth factors HGF and KGF may play a role in enhancing IL-1-stimulated production of IL-8 by epithelial cells during mucosal inflammations.PMID:21082280
KGF increases pigment production and deposition in melanocytes in vitro and in vivoPMID:19780816
The upregulation of KGF/KGFR might induce the formation of rete ridges and hyperpigmentation in solar lentigines.PMID:20620021
Modulation of calprotectin in human keratinocytes by keratinocyte growth factor and interleukin-1alpha.PMID:20065999
the expression of keratinocyte growth factor (KGF) and keratinocyte growth factor receptor (KGFR) in Hela cellsPMID:17593825
KGF and KGFR are both expressed in CaSki cells. Autocrine and recombinant human KGF affect cell proliferation and migration.PMID:17953372
keratinocyte growth factor works via an inducible lentivirus to protect bone marrow cells against bleomycin-induced pulmonary fibrosisPMID:19956603
The goal of this study was to elucidate the control mechanisms by which exogenous proteins regulate keratinocyte growth factor (KGF) expression in fibroblasts adhered to differing substrates.PMID:20036421
The effect of KGF on limbal epithelial cell growth is mediated by upregulation of DeltaNp63alpha through the p38 pathway.PMID:19920075
KGF induced proliferation but did not cause significant differentiation of 3 hematopoietic cell lines and bone marrow cells transduced with human K-sam.PMID:11937263
play important roles in lung development, lung inflammation, and repair.PMID:11943656
keratinocyte growth factor (KGF), a key stimulator of epithelial cell proliferation during wound healing, preferentially binds to collagens I, III, and VI.PMID:11973338
KGF may hold promise for the treatment of very premature neonates with bronchopulmonary dysplasia.PMID:12016100
Following activation by KGF binding, KGF and the KGF receptor remain associated in active complexes through the endocytic pathway, which is described.PMID:12122441