Abbreviation
Recombinant Human FGF7 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using Mv.1.Lu Mink lung epithelial cells. The ED50 for this effect is ≤10 ng/mL.
Alternative Names
Fibroblast growth factor 7; FGF-7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor; FGF7; KGF
Species
Homo sapiens (Human)
Expression Region
32-194aa
Target Protein Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
FGF7 selectively drives epithelial cell proliferation through high-affinity binding to FGFR2-IIIb, making it a critical tool for dissecting epithelial–mesenchymal signaling in wound repair and organoid culture systems. This mammalian-expressed protein spans the complete mature form (aa 32–194) and demonstrates robust mitogenic activity in Mv.1.Lu mink lung epithelial cells with an ED50 ≤10 ng/mL, providing a quantitative benchmark for dose-response studies in cell proliferation assays and stem cell differentiation protocols targeting epithelial lineages. The choice of mammalian expression ensures native post-translational modifications that preserve receptor-binding kinetics relevant to ELISA-based receptor–ligand competition assays and surface plasmon resonance experiments. Purity exceeding 95% by SDS-PAGE and endotoxin levels ≤10 EU/mg align with standards expected in wound healing models and in vivo regenerative medicine studies where low endotoxin burden is essential for interpreting epithelial responses without confounding inflammatory signals.