Abbreviation
Recombinant Rhesus macaque TNF protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta TNF at 2 μg/mL can bind Human TNFRSF1A(CSB-MP023977HU1). The EC50 is 9.112-9.954 ng/mL.
Alternative Names
Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a); TNF; TNFA, TNFSF2
Species
Macaca mulatta (Rhesus macaque)
Expression Region
77-233aa
Target Protein Sequence
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta TNF at 2 μg/ml can bind Human TNFRSF1A(CSB-MP023977HU1). The EC50 is 9.112-9.954 ng/mL.
Description
TNF-α drives pleiotropic inflammatory and apoptotic responses in both human and non-human primate models, making ortholog fidelity essential when translating findings from rhesus macaque studies to clinical contexts. This protein, spanning residues 77–233 of the mature macaque TNF sequence and expressed in mammalian cells, binds human TNFRSF1A with an EC50 of 9.1–10.0 ng/mL in functional ELISA, confirming receptor engagement at physiologically relevant concentrations and supporting its use in cross-species receptor-binding assays, NF-κB and MAPK signaling pathway studies, and as a positive control in cytokine detection platforms. Endotoxin levels below 1.0 EU/μg meet the thresholds commonly required for primary immune cell activation assays—including PBMC stimulation and T-cell differentiation experiments—where LPS contamination would confound TNF-specific responses. Purity exceeding 90% by SDS-PAGE, combined with the validated receptor interaction, provides a suitable basis for antibody development workflows and in vivo macaque inflammation models.