Abbreviation
Recombinant Human ULBP1 protein, Biotinylated (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Alternative Names
(ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-216aa
Target Protein Sequence
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Description
ULBP1 engages the activating receptor NKG2D (KLRK1) on NK cells and cytotoxic T cells, making it a critical target in immuno-oncology research focused on tumor immune surveillance. This recombinant human ULBP1 covers the full mature protein (aa 26–216), is expressed in mammalian cells to preserve native folding and glycosylation, and carries a C-terminal mFc-Avi tag with site-specific biotinylation for oriented capture on streptavidin surfaces. Functional ELISA confirms robust KLRK1 binding with an EC₅₀ of 4.254–7.295 ng/ml against immobilized KLRK1 at 10 μg/ml, supporting use in receptor–ligand binding assays, NKG2D pathway blocking studies, and development of screening platforms for antibody or checkpoint modulator candidates. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based NK cytotoxicity assays and in vitro immune activation experiments.
