Recombinant Human UL16-binding protein 1 (ULBP1),Biotinylated (Active)

CSB-MP887177HUj1-B
Size:
20ug
20ug100ug1mg
US$166
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal mFc-Avi-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Target Names
ULBP1
Uniprot NO.
Alternative Names
(ALCAN-beta)(NKG2D ligand 1)(N2DL-1)(NKG2DL1)(Retinoic acid early transcript 1I)(N2DL1)(RAET1I)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-216aa
Target Protein Sequence
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Mol. Weight
51.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc-Avi-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
Description

The recombinant human ULBP1 protein is a biotinylated protein with relatively high bioactivity. It is produced in mammalian cells and fused with an mFc-Avi-tag at the C-terminus. Its expression region corresponds to amino acid residues 26-216 of the human ULBP1 protein. The purity of this ULBP1 protein is measured by SDS-PAGE and reaches up to 95%. On the gel, it has an apparent molecular mass of 67 kDa due to glycosylation. It contains low levels of endotoxin, less than 1.0 EU/ug determined by the LAL method. In the functional ELISA, this biotinylated ULBP1 can bind to the KLRK1, with EC50 of 4.254-7.295 ng/ml. This biotinylated ULBP1 could be used to isolate ULBP1 antibodies from samples for subsequent analyses with high sensitivity. And it is available now.

ULBP1 is a stress-induced ligand for the activatory receptor NKG2D. It is found as a cell-surface protein on some malignant cells including human hepatocellular carcinomas. Upregulation of ULBP1 is detected during HCMV infection.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Gene References into Functions
  1. we show that Simian Virus 40 (SV40)...evades NK cell attack through the down regulation of...ULBP1 PMID:26992229
  2. ATF4 drives ULBP1 gene expression in cancer cell lines, while the RNA-binding protein RBM4 supports ULBP1 expression by suppressing a novel alternatively spliced isoform of ULBP1 mRNA. PMID:26565589
  3. expression determines intrinsic acute myeloid leukemia susceptibility to allogeneic V[gamma]9V[delta]2 T cells PMID:24911793
  4. recurrence-free survival of patients with ULBP1-negative hepatocellular carcinoma (HCC) was significantly shorter than that of patients with ULBP1-positive HCC PMID:21756848
  5. recombinant ULBP1 fused to CD45 caused a reduction in cytotoxicity and degranulation by NK cells, implying a role for receptor ligand distribution in the activation of NK cell responses PMID:21464092
  6. Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID:20220060
  7. These results identify Mult1 as a target for the MARCH family of E3 ligases PMID:20870941
  8. As NKG2D ligand, ULBP1 are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC. PMID:18394338
  9. Data show that the protease NS3/4A of HCV down-regulates ULBP1 expression by inhibiting the transcription of ULBP1. PMID:19500498
  10. ULBP1 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells. PMID:11777960
  11. The NKG2D ligand ULBP1 is up-regulated and readily detectable intracellularly in the endoplasmic reticulum of human cytomegalovirus-infected fibroblasts, where it colocalizes with viral protein UL16. PMID:12847260
  12. ULBP1 is a human ligand of the NKG2D receptor PMID:16901903
  13. The selective induction of ULBP1 expression by proteasome inhibitor drugs, along with variable NKG2D ligand expression by human tumor cells, indicates that NKG2D ligand genes are independently regulated. PMID:19414815

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum.
Protein Families
MHC class I family
Tissue Specificity
Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
Database Links

HGNC: 14893

UNIGENE: Hs.653255

KEGG: hsa:80329

STRING: 9606.ENSP00000229708

OMIM: 605697

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products