Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial (Active)

In Stock
Code: CSB-MP023978HU2
Size:
20ug
20ug100ug1mg
US$116
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc1-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TNFRSF1B protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.
Target Names
TNFRSF1B
Uniprot NO.
Research Area
Cancer
Alternative Names
(Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD120b) (Etanercept) (TBP-2) (TBPII)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-257aa
Target Protein Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.1 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.
Description

TNFRSF1B (TNF-R2/p75) mediates critical TNF-α signaling in immune regulation and tumor microenvironment modulation, making it a key target in oncology drug discovery. This recombinant human TNFR2 construct spans the extracellular ligand-binding domain (aa 23–257) with a C-terminal hFc1 tag, and its functional integrity is confirmed by ELISA binding to immobilized TNF-α with an EC50 of 1.162–1.481 ng/ml, supporting use in ligand-receptor interaction assays, competitive inhibition studies, and blocking antibody screening. Mammalian cell expression preserves native glycosylation and disulfide-dependent folding essential for conformationally accurate epitope mapping and affinity characterization by SPR or BLI. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for therapeutic antibody validation and small-molecule inhibitor screening in cancer-focused programs.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
4.0 - 1 reviews

Submit a Review here

Applications : Antigen

Review: We validated the binding activity of human TNFRSF1B and ligand human TNFRSF1B through functional ELISA, and the results showed good binding activity, which is basically consistent with the data on the website. It was subsequently used as an antigen to immunize mouse, the titer was high, and ideal positive clones were screened through ELISA screening!

By Anonymous

Target Background

Function(From Uniprot)
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Gene References into Functions
  1. TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID:29748156
  2. Data suggest that maternal glycemic response during pregnancy is associated with lower DNA methylation of 4 CpG sites within PDE4B gene in placenta (collected after normal-weight term birth); 3 additional CpG sites are differentially methylated relative to maternal glucose response within TNFRSF1B, LDLR, and BLM genes. (PDE4B = phosphodiesterase-4B; LDLR = low density lipoprotein receptor; BLM = Bloom syndrome protein) PMID:29752424
  3. serum level did not change after tonsillectomy alone but decreased significantly after steroid pulse therapy in patients with IgA nephropathy PMID:28389814
  4. Elevated serum TNFR2 may be a possible marker of COPD in asymptomatic smokers and ex-smokers. PMID:28744116
  5. TNFR2 promoted Adriamycin resistance in breast cancer cells by regulating the DNA damage repair. PMID:28677724
  6. Serum TNFR2 is a biomarker for patients with chronic kidney disease. PMID:28667032
  7. Data indicate activators of tumor necrosis factor receptor 2 (TNFR2) and a potential role for this target in immunotherapy. PMID:27626702
  8. In this study, we identified a novel association between ANCA levels, TNFRSF1B genotype and decreased circulating TNFR2 levels, which may be reflective of the underlying biological mechanisms that determine clinical expression and/or response to certain therapies. PMID:27104820
  9. In Han Chinese population of Hunan province, TNFRSF1B+676 gene polymorphisms are not associated with the genetic risk of rheumatoid arthritis PMID:27640805
  10. Results showed that TNFR2 was upregulated in papillary thyroid carcinoma tissues, and its expression is regulated by H19. PMID:29287713
  11. The TNFRSF1Brs3397 variant may play a role in modulating the risk of rheumatoid arthritis, but does not provide strong evidence of an impact of TNFRSF1B variants in determining response to anti-TNF drugs. PMID:25850964
  12. atopic dermatits patients had increased TNFR2 expression on immune cells PMID:29212072
  13. the blocking of tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID:27081759
  14. Data suggest that, by targeting tumor cells and immunosuppressive tumor-associated Tregs, antagonistic tumor necrosis factor receptor 2 (TNFR2) antibodies may be an effective treatment for cancers positive for TNFR2. PMID:28096513
  15. p75 neurotrophin receptor (p75TNFR) was the first NGFR (nerve growth factor receptor) to be cloned and the founding member of the TNFR (tumor necrosis factor receptor) superfamily. However, data suggest that p75TNF is an atypical TNFR superfamily protein; p75TNFR forms dimers (activated by dimeric neurotrophins) that are structurally unrelated to TNFR superfamily proteins. [REVIEW] PMID:28215307
  16. High plasma levels of TNFR2 and TNFR1 were associated with incident intracerebral hemorrhage. PMID:28830973
  17. Serum TNFR2 levels were elevated in lupus nephritis patients versus controls. PMID:27973968
  18. Voxel-based morphometry was used to analyse the associations between TNFRSF1B (rs1061624) genotypes and grey matter structure. Analysis of the TNFRSF1B SNP rs1061624 yielded a significant association with hippocampal but not with striatal volume, whereby G homozygotes were associated with increased volumes relative to A homozygotes and heterozygotes. PMID:27528091
  19. Our results demonstrated that Treg frequencies and TNFR2 expression on Tregs are increased in sarcoidosis, followed by a decline during infliximab therapy, suggesting a pathophysiological role of this T cell subset. PMID:27158798
  20. identified 6 known and 4 novel variations in 6 different exons of TNFR2 gene; out of these identified variations, 5 known variations were found to be significantly associated with the risk of cervical cancer; postmenopausal women having CAAGC + CTGCC haplotypes in TNFR2 gene along with HPV infection and tobacco consumption may lead to the development of cervical cancer PMID:27145290
  21. LTbetaR is essential for efficient liver regeneration and cooperates with TNFRp55 in this process. Differences in survival kinetics strongly suggest distinct functions for these two cytokine receptors in liver regeneration. PMID:26708145
  22. that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration PMID:26476273
  23. TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB. PMID:26492598
  24. This meta-analysis demonstrates that TNFRSF1B T allele carriers show a better response to anti-TNF therapy--{REVIEW} PMID:26071216
  25. Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury. PMID:26425877
  26. NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID:26569118
  27. our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver PMID:26483205
  28. In conclusion, we report a significant association between the TNFRSF1B p.M196R variant and the risk for psoriasis and the response to treatment with anti-TNF or anti-Il-12/Il-23. PMID:25537528
  29. Plasma sTNFR2 was higher during pregnancy compared with controls. Urinary levels of sTNFR2 were higher in preeclampsia and pregnant women compared with controls. PMID:25034210
  30. study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis PMID:26280204
  31. Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome. PMID:26258847
  32. Increased plasma level of sTNFRII is found to be associated with exudative age-related macular degeneration. PMID:25363549
  33. ADAM17 was identified as the protease responsible for TNFR2 shedding by CD8(+) T cells, with ADAM17 and TNFR2 required in "cis" for shedding to occur. PMID:26019295
  34. hTNFR2 blocks the biological activity of lymphotoxin beta. PMID:25940088
  35. NRH2 enhanced the ratio of Bax/Bcl-2 by promoting the expressions of proNGF, sortilin and p75NTR, thereby inducing brain cell apoptosis. PMID:25854576
  36. Only TNFR2 can induce TRAF2 degradation. PMID:25152365
  37. Data show that TNF-alpha receptor TNFR2 mRNA expression was significantly increased after 6, 9 and 12 hours of poly (I:C) stimulation. PMID:25419735
  38. Functional TNFR2 196 M/R polymorphism is associated with susceptibility to rheumatoid arthritis in the European population. PMID:24777778
  39. Serum TNFR2 is associated with renal decline and ESRD risk in type 1 diabetes and proteinuria. PMID:24898299
  40. The TNFRII nt587 G/G genotype may increase the risk of developing AS in the Chinese population. PMID:25061744
  41. High TNF receptor 2 is closely associated with the loss of kidney function. PMID:24717758
  42. Inflammation mediated through TNFalpha and its receptors, TNFR1 and TNFR2, may represent an important component of a comorbidity-induced inflammatory response that partially drives the pathophysiology of heart failure (HF) with preserved ejection fraction. PMID:24923671
  43. TNF-TNFR2 signaling may induce RBR in naive BM-EPCs and that blocking TNF-TNFR2 signaling may prevent delayed RBR in BM-EPCs, conceivably, in bone marrow milieu in general PMID:24711449
  44. Blood levels of CRP, IL-6 and TNFalpha-R2 are not associated with incident depression. PMID:24836084
  45. Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID:24310780
  46. Higher plasma TNFR75 levels were associated with decreased time to first COPD exacerbatino in a prospective study. PMID:24136332
  47. Our results support a role of TNFRSF1B gene variants in the response to IFX in CD patients. PMID:24121042
  48. Serum TNFR2 expression levels might be a powerful prognostic factor for patients treated with the R-CHOP regimen. PMID:23672298
  49. Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression. PMID:23861542
  50. genetic association studies in a population of women in Tunisia: Data suggest that an SNP in exon 6 of TNFR2/TNFRSF1B (rs1061622) is associated with pre-eclampsia. PMID:23799986

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted.
Database Links

HGNC: 11917

UNIGENE: Hs.256278

KEGG: hsa:7133

STRING: 9606.ENSP00000365435

OMIM: 191191

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products