Recombinant Human Parathyroid hormone (PTH) (Active)

In Stock Discontinued
Code: CSB-AP005621HU
Size:
10ug
10ug50ug500ug1mg(1mg*1 or 500ug*2)
US$204
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to induce cAMP accumulation in MC3T3?E1 mouse preosteoblast cells is less than 0.1 ug/ml
Target Names
PTH
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
hPTH; Parathormone; Parathyrin; Parathyroid hormone 1; Parathyroid hormone; Prepro PTH; Preproparathyroid hormone; PTH; PTH1; PTH1 receptor; PTH1R; PTHR; PTHR1; PTHY_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
32-115aa
Target Protein Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Human PTH is a full-length mature protein representing the 32-115aa expression region of Parathyroid hormone, a crucial factor in signal transduction research. Produced in E. coli, this tag-free protein has a purity greater than 95% as determined by SDS-PAGE, with endotoxin levels below 1.0 EU/µg as measured by the LAL method. Demonstrating high biological activity, PTH exhibits an ED50 of less than 0.1 ug/mL in its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells. The product is provided as a lyophilized powder, facilitating convenient storage and application in research settings.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Gene References into Functions
  1. Among subjects with preserved renal function, PTH levels were possibly associated with metabolic syndrome in females, whereas vitamin D levels exhibited a possible link to metabolic syndrome in males. PMID:29348466
  2. Data suggest that, in pregnant women with largely sufficient calcium intakes (via diet and dietary supplements), serum 25-hydroxyvitamin D (total of 25[OH]D2 and 25[OH]D3) is important for maintaining normal serum PTH levels; this study was conducted in group of white-skinned women at northern latitudes in Ireland. PMID:30018262
  3. In conclusion, Fetuin A, vitamin D, and intact PTH levels were all associated with sarcopenia in this geriatric population. Among them, intact PTH specifically indicates patients with sarcopenic left ventricular hypertrophy. PMID:28112206
  4. Dkk-1 and PTH levels in psoriatic arthritis are lower than healthy female controls, in contrast with rheumatoid arthritis, in which they are increased PMID:28634697
  5. Scientific evidence of genetic association of serum PTH level among individuals with different pathologic conditions remains deficient and published results provide weak evidence (review and meta-analysis). PMID:29794776
  6. Clinical data on secondary hyperparathyroidism, mainly derived from patients with chronic kidney disease, indicate a potential inverse association between leptin (LEP) and parathyroid hormone (PTH) in some, but not all studies. [REVIEW] PMID:28730419
  7. Parathyroid hormone controls bone and kidney homeostasis via GNAS and Gq-G11 heterotrimeric G proteins. (Review) PMID:28363951
  8. Patients with chronic kidney disease undergoing parathyroidectomy for primary hyperparathyroidism have similar intraoperative parathyroid hormone degradation kinetics to those with normal kidney function. PMID:29128188
  9. PTH levels are significantly higher in untreated sustained hypertension patients than white-coat hypertension patients and normotensive subjects. PMID:29176783
  10. results revealed that PTH treatment on HCs, either continuous or pulsatile, does not exhibit any positive effect, and indicates that exogenous PTH administration after fracture has no effect on HCs. PTH may not have a positive effect at the fracture site during the early stage of fracture healing in which haematoma formation occurs. PMID:24039091
  11. Pre-incubation of muscle fibers or myotubes with physiological concentrations of PTH, concentration-dependently reduced uptake of labelled 25-hydroxyvitamin D3. PMID:28104493
  12. Baseline PTH level was not associated with changes in frailty status in men. PMID:28609827
  13. Elevated PTH induces the transition of endothelial cells to chondrogenic cells via endothelial-mesenchymal transition, possibly mediated by the nuclear translocation of beta-catenin. PMID:27582099
  14. Cys mutation at the 25th residue of hPTH(1-34) may result in a high bone mass phenotype. PMID:27300576
  15. Common genetic variants located near genes involved in vitamin D metabolism and calcium and renal phosphate transport associated with differences in circulating parathyroid hormone concentrations PMID:27927781
  16. PTH pretreatment prevented TGF-beta1 and high glucose-induced Smad2/3 phosphorylation and consequent upregulation of fibronectin and type IV collagen within 4 h. PMID:27530924
  17. FGFR1c and PTHR signaling pathways converge on NHERF1 to inhibit PTH- and FGF23-sensitive phosphate transport and down-regulate NPT2A. PMID:27432882
  18. The present study supports the independent pathogenic effect of rs6254GA polymorphism on the development and severity of bone mineral density complications in patients with asymptomatic but not normocalcemic hyperparathyroidism. PMID:27756092
  19. In patients receiving dual antiplatelet therapy for coronary artery disease, higher PTH levels are associated with an increased ADP-mediated platelet reactivity and suboptimal response to clopidogrel. PMID:27086085
  20. Parathyroid hormone gene rs6256 variants are not associated with susceptibility to colorectal cancer PMID:25124570
  21. PTH levels were significantly higher in patients with aldosterone producing adenomas. PMID:26304960
  22. Although there was a trend for a negative association in women, no statistically significant association was found between endogenous PTH and knee osteoarthritis. PMID:25879737
  23. The purpose of this study was to investigate the prevalence of adenomatous colon polyps (ACP) as they occur in subjects with diabetes mellitus (DM) and chronic kidney disease. PMID:27993873
  24. PTH [parathyroid hormone]together with other markers of heart failure may provide valuable information both in the diagnosis and staging of heart failure syndromes PMID:27546695
  25. Patients with a serum PTH decrease to low values after 1 year of hemodialysis treatment are at high risk of short-term cardiovascular death. PMID:26880460
  26. a cell model of human dermal fibroblasts in order to investigate the functions of sclerostin, is reported. PMID:26851122
  27. recombinant human klotho inhibits the expression of 1-OH by PTH both in vitro and in vivo. PMID:26287968
  28. results suggest that NO-mediated vasorelaxation plays partly a role in the anabolic action of PTH on cortical bone PMID:26834008
  29. In this large community-based cohort, PTH levels, overall, were not independently associated with the risk of hypertension. However, we found some evidence that PTH may be associated with hypertension in blacks. PMID:26867053
  30. The objective of this article is to investigate the effect of renin-angiotensin system inhibitors (RASIs) on intact parathyroid hormone (iPTH) levels in continuous ambulatory peritoneal dialysis (CAPD) patients. PMID:25271253
  31. PTH does not contribute to the occurrence of metabolic components of obesity, but there is a positive correlation between 25(OH)D and HDL-C. PMID:26451492
  32. Data suggest that effects of PTH on bone remodeling are mediated not only by osteoblasts/osteocytes but also by T-lymphocytes in bone marrow; T-lymphocytes regulate differentiation/life span of stromal cells and their responsiveness to PTH. [REVIEW] PMID:26662934
  33. Serum secreted i-PTH level might not be predictable by a total mass of parathyroid glands or by their blood supply. PMID:26997379
  34. A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism. PMID:25891861
  35. Study indicates significant association between specific PTH gene promoter region variants and altered levels of 25(OH)D and vitamin D deficiency among specific nationals. PMID:26339419
  36. Elevation of PTH, unlike vitamin D, is independently associated with Chronic Obstructive Pulmonary Disease (COPD) severity, and may be a better biomarker for COPD. PMID:26398210
  37. Abnormal diurnal patterns of PTH are associated with sustained mild hypercalcemia in nondialyzed chronic kidney disease patients. PMID:27012036
  38. These data indicate that ephrinB2/EphB4 signaling within the osteoblast lineage is required for late stages of osteoblast differentiation. PMID:23165727
  39. Serum 25(OH)D levels were inversely associated with serum PTH and bone mineral density. PMID:23045165
  40. Elevated parathyroid hormone serum concentrations might have a role in colorectal cancer development as indicated by higher rates of adenomas, specifically with dysplasia, in women. PMID:26021763
  41. the iPTH level in ESRD patients carrying VDR BsmI Bb genotype was higher than that in ESRD patients carrying bb genotype in overall populations and in Caucasians PMID:25007156
  42. The identification of PTH and other hormonal resistances implies to look for the genetic disorder supporting the metabolic disorder--{REVIEW} PMID:25913526
  43. Intraoperative PTH monitoring during parathyroidectomy to determine PTH clearance proved to be a feasible marker for adequacy and safety of surgery and "cure". PMID:25241609
  44. Data suggest serum PTH level is independently associated with bone mineral density (BMD) in vitamin D-sufficient women and vitamin D-insufficient women; no association was found in men; high serum PTH is detrimental on BMD in postmenopausal women. PMID:25242259
  45. In a racially/ethnically diverse population without prevalent cardiovascular disease, higher serum PTH concentration was associated with increased left ventricular mass and increased risk of incident heart failure. PMID:25468653
  46. In a large community-based sample of elderly, calcium was independently associated with increased arterial stiffness, and PTH independently to intra-arterial peripheral and calculated central blood pressures. PMID:25562577
  47. Suggest that measurement of iPTH may be useful for assessment of mineral bone disorder in patients with chronic kidney disease. PMID:26299086
  48. A detailed characterization of in vitro generated amyloid fibrils from human parathyroid hormone (hPTH(1-84)). PMID:25554227
  49. salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity. PMID:25218037
  50. A panel of easily assessable determinants could account for both a substantial proportion of PTH variance and the occurrence of secondary hyperparathyroidism. PMID:24202062

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Parathyroid hormone family
Database Links

HGNC: 9606

UNIGENE: Hs.37045

KEGG: hsa:5741

STRING: 9606.ENSP00000282091

OMIM: 146200

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products