Abbreviation
Recombinant Human SCF protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 5-8 ng/mL
Alternative Names
Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF
Species
Homo sapiens (Human)
Expression Region
26-190aa
Target Protein Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Kit ligand drives the survival and proliferation of hematopoietic progenitors, mast cells, and melanocytes through c-Kit receptor activation, making it a critical tool for studies of hematopoiesis, mast cell biology, and stem cell maintenance. This tag-free protein, spanning residues 26–190 of the mature human sequence, demonstrates robust bioactivity in TF-1 cell proliferation assays with an ED50 of 5–8 ng/mL, providing a quantitative benchmark for dose-response experiments in cell-based functional studies and JAK/STAT signaling pathway analysis. Endotoxin levels ≤10 EU/mg meet the quality thresholds commonly required for primary cell cultures and assays involving immune-responsive cell types, where LPS contamination would confound cytokine-specific effects. Purity exceeding 95% by SDS-PAGE, combined with the validated proliferative potency, supports its use as a positive control in ELISA development, a reference standard in cytokine detection platforms, and a defined supplement in serum-free culture systems for hematopoietic and stem cell research.