Abbreviation
Recombinant Human KITLG protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.
Alternative Names
Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand
Species
Homo sapiens (Human)
Expression Region
26-189aa
Target Protein Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.
-
The purity of KITLG was greater than 95% as determined by SEC-HPLC
Description
Kit ligand drives the survival, proliferation, and differentiation of hematopoietic progenitors and mast cells through c-Kit receptor engagement, making it indispensable for studies of hematopoiesis, mast cell biology, and stem cell niche signaling. This recombinant human KITLG, spanning residues 26–189 and expressed in mammalian cells to preserve native glycosylation, demonstrates an ED50 of 1.813–3.203 ng/mL in MO7e cell proliferation assays, confirming potent receptor activation suitable for dose-response studies in TF-1 cells, primary hematopoietic progenitors, and mast cell differentiation protocols. The low endotoxin level (< 1.0 EU/μg) and > 95% purity meet the quality thresholds commonly required for immune cell functional assays, where LPS contamination would confound cytokine-specific responses, and support use in JAK/STAT and MAPK signaling pathway analyses. Researchers can apply this protein as a positive control in ELISA-based cytokine detection platforms or as an immunogen for antibody development targeting the soluble Kit ligand isoform.
