Abbreviation
Recombinant Human KITLG protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1-5 ng/ml.
Alternative Names
C kit ligand; C-kit ligand; Ckit ligand; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; KIT ligand; Kitl; KITLG; KL 1; KL1; Mast cell growth factor; MGF; MGF stem cell factor; SCF; SCF_HUMAN; SF; SHEP7; sKITLG; Soluble KIT ligand; Steel factor; steel, mouse, homolog of; Stem cell factor; Stem cell factor precursor
Species
Homo sapiens (Human)
Expression Region
26-189aa
Target Protein Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
Stem cell factor (SCF) drives c-Kit receptor activation to regulate hematopoietic progenitor survival, proliferation, and differentiation, making it indispensable for ex vivo expansion protocols and mast cell biology studies. This tag-free recombinant human KITLG (aa 26–189) demonstrates an ED50 of 1–5 ng/mL in TF-1 erythroleukemic cell proliferation assays, confirming robust signaling potency suitable for JAK/STAT and MAPK pathway activation studies, hematopoietic differentiation experiments, and use as a reference standard in SCF detection assays. The endotoxin level below 1.0 EU/μg eliminates LPS-driven artifacts that confound immune cell functional readouts, supporting use in primary cell proliferation assays and in vivo models of hematopoiesis or tumor biology. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, satisfies the criteria typical for antibody development workflows including immunization, ELISA coating, and positive control applications.