Abbreviation
Recombinant Human KITLG protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human KIT(CSB-MP012375HU1) at 2 μg/mL can bind Human KITLG. The EC50 is 0.6921-0.8551 ng/mL.
Alternative Names
Kit ligand; Mast cell growth factor; MGF; Stem cell factor; SCF; c-Kit ligand [Cleaved into: Soluble KIT ligand; sKITLG]
Species
Homo sapiens (Human)
Expression Region
26-189aa
Target Protein Sequence
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human KIT(CSB-MP012375HU1) at 2 μg/ml can bind Human KITLG. The EC50 is 0.6921-0.8551 ng/mL.
Description
Kit ligand drives hematopoietic stem cell survival and mast cell differentiation through c-Kit receptor engagement, making quantitative binding data essential for interpreting dose-dependent responses in these lineages. This mammalian-expressed fragment spanning residues 26–189 demonstrates an EC50 of 0.69–0.86 ng/mL in a functional ELISA against immobilized human KIT receptor, providing a validated basis for cell proliferation assays with KIT-dependent lines such as TF-1 cells and for signaling pathway studies examining JAK/STAT or MAPK activation downstream of receptor ligation. The endotoxin level below 1.0 EU/μg satisfies the contamination thresholds typical for primary hematopoietic cell cultures and mast cell differentiation protocols, where LPS artifacts would confound cytokine-specific readouts. Purity exceeding 90% by SDS-PAGE supports its use as a coating antigen in antibody development workflows and as a positive control in cytokine detection platforms.
