Abbreviation
Recombinant Human GPC3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC50 is 0.2007-0.2567 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC50 is 0.3261-0.3657 ng/mL.
Alternative Names
Glypican-3; GTR2-2; Intestinal protein OCI-5; MXR7 [Cleaved into: Glypican-3 alpha subunit; Glypican-3 beta subunit]
Species
Homo sapiens (Human)
Expression Region
524-563aa
Target Protein Sequence
AELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal mFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC50 is 0.2007-0.2567 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC50 is 0.3261-0.3657 ng/mL.
-
The purity of GPC3 was greater than 95% as determined by SEC-HPLC
Description
Glypican-3 serves as a diagnostic and therapeutic target in hepatocellular carcinoma and other malignancies, yet reliable reagents for antibody validation remain scarce. This mammalian-expressed fragment spanning residues 524–563 demonstrates robust antibody-binding capacity in functional ELISA, with EC50 values of 0.20–0.26 ng/mL and 0.33–0.37 ng/mL against two distinct anti-GPC3 recombinant antibodies, confirming epitope accessibility and structural fidelity. The quantitative binding data supports its use as a coating antigen for antibody validation assays, enabling researchers to assess specificity and affinity of GPC3-targeting therapeutics or diagnostics. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in cancer invasion models and receptor interaction studies where low background interference is critical.