Home
Product
Protein
Active Protein
Interleukin
Recombinant Human Interleukin-36 alpha (IL36A) (Active)

Recombinant Human Interleukin-36 alpha (IL36A) (Active)

In Stock Discontinued

Code: CSB-AP004421HU

Rate （N/A）
Review （0）

Size:

10μg50μg500μg1mg(1mg*1 or 500ug*2)

US$195

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to inhibit IL-8 secretion in A431 human epithelial carcinoma cells is less than 50 ng/ml.

Uniprot NO.

Q9UHA7

Research Area

Immunology

Alternative Names

FIL1; FIL1 epsilon; FIL1(EPSILON); FIL1E; IL 1 epsilon; IL 1F6; IL 1H1; IL-1 epsilon; IL-1F6; IL1E; IL1F6; IL1F6_HUMAN; IL1RP2; IL36 alpha; IL36A; Interleukin 1 epsilon; Interleukin 1 family member 6 (epsilon); Interleukin 1 family member 6; Interleukin 36 alpha; Interleukin-1 epsilon; Interleukin-1 family member 6; MGC129552; MGC129553; MGC151479; MGC151481; OTTMUSP00000012798; RP23-176J12.4

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-158aa

Target Protein Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17.7 kDa

Protein Length

Full Length

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. May play a role in proinflammatory effects in the lung.

Gene References into Functions

serum IL-36alpha levels were higher in active systemic lupus erythematosus patients and correlated with disease activity and arthritis PMID:29571080
Data suggest that interleukin-36alpha (IL-36alpha) plays an important role in the pathophysiology of inflammation and fibrosis in the pancreas via an autocrine function. PMID:28099250
The data identify a novel role for IL-36 signaling in colonic inflammation and indicate that the IL-36R pathway may represent a novel target for therapeutic intervention. PMID:26813344
IL-36a was displayed to be able to suppress the growth of epithelial ovarian cancer cells in our setting, which is suggestive of its druggable potential in curing the epithelial ovarian cancer and that upregulation of IL-36a was found to be capable of inhibiting the growth of epithelial ovarian cancer cells. PMID:28621240
Increased Expression of Interleukin-36 is associated with Inflammatory Bowel Disease. PMID:26752465
IL-36alpha acts as a pro-inflammatory cytokine at cartilage level, by increasing the expression of markers of inflammation and cartilage catabolism. PMID:26560022
Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production. PMID:26516833
increases maturation of monocyte-derived dendritic cells PMID:25700962
IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome. PMID:25902739
IL-36alpha was highly expressed in nearly half of all colorectal cancer patients. Low expression level of IL-36alpha correlated with larger tumor size and advanced cancer stage. Low expression of IL-36alpha resulted in a poor prognosis of colorectal cancer patients. PMID:25550854
Results show that IL-36alpha expression may play a pivotal role in determining the prognosis of hepatocellular carcinoma (HCC). PMID:24061617
The novel cytokine interleukin-36alpha is expressed in psoriatic and rheumatoid arthritis synovium. PMID:23268368
Expression of IL-1F6 is increased in human plaque psoriasis skin and in the lesional skin of transgenic mice compared with monotransgenic littermates. PMID:21242515
A functional IL-6 polymorphism has been weakly associated with level of peak bone mineral density and the rate of forearm trabecular postmenopausal bone loss in a cohort of women. PMID:12110411
Dysregulated expression in transgenic mice can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. PMID:17908936
IL-1 epsilon, an interleukin-1 agonist, activates NF-kappa B through the orphan IL-1 receptor-related protein 2 and may constitute part of an independent signaling system present in human epithelial barriers. PMID:11466363

Hide All

Subcellular Location

Cytoplasm. Secreted.

Protein Families

IL-1 family

Tissue Specificity

Expressed in immune system and fetal brain, but not in other tissues tested or in multiple hematopoietic cell lines. Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Increased in lesional psoriasis sk

Database Links

HGNC: 15562

UNIGENE: Hs.278910

KEGG: hsa:27179

STRING: 9606.ENSP00000259211

OMIM: 605509

Promotions