MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Gene References into Functions
these findings provide the direct evidence that ADAM17 cleaves porcine TNFalpha, which represents a new view for identifying potential therapeutic targets in anti-porcine reproductive and respiratory syndrome virus therapyPMID:26724939
TMZ pretreatment effectively reduced the myocardial damage caused by CME via inhibiting the PDCD4/NF-kappaB/ TNF-alpha pathway in cardiomyocytes.PMID:28683436
TNF-alpha, secreted from activated Monocytes, mediates the downregulation of OTX2 and essential retinal pigment epithelium genes.PMID:27660103
TNF-alpha induced MMP-13 expression by condylar cells might be involved in the degradation of the juvenile condyle.PMID:27618228
TNF-alpha was able to promote theca interna cell proliferation. Our results suggest that TNF-alpha might play a role in hyperandrogenism, cortex thickness, and the increased ovary volume observed in polycystic ovaries.PMID:27125399
This study showed that the -791(C-->T) mutation of the TNF-alpha gene could be considered an important potential genetic marker of enterotoxigenic Escherichia coli F18 resistance.PMID:27408333
Both Nsp1beta and Nsp11 of porcine reproductive and respiratory syndrome virus were demonstrated to be responsible for the inhibitory effect on TNF-alpha production in pulmonary alveolar macrophages.PMID:25708177
Study presents evidence demonstrating a single species of exotoxin ApxI, derived from A. pleuropneumoniae serotype 10, induces the expression and production of proinflammatory cytokines IL-1beta, IL-8 and TNF-alpha in porcine alveolar macrophages.PMID:21314908
the role of miR-181a in adipocyte differentiation by regulation of TNF-alphaPMID:24098322
The NOS inhibitor, L-NMMA, significantly suppressed the combined effects of HT and CORM-2 on TNFalpha-triggered NFkappaBp65 phosphorylation as well as decreased cell viability.PMID:24066302
High-volume hemofiltration improves hemodynamics and heart dysfunction in septic shock pigs, which may be attributed to reduction of TNF-alpha in myocardium but not in circulation.PMID:22994292
Basal lipogenesis was not affected by tumor necrosis factor alpha (TNFalpha) treatment; however, insulin stimulated lipogenesis was reduced by TNFalpha. Interleukin 6 and TNFalpha gene expression were acutely (2-4 h) stimulated by exogenous TNFalpha treatment.PMID:23090779
In swine, IL-8, TNF-ALPHA, INOS AND MIP-1BETA were increased during mechanical ventilation in a time-related fashion.PMID:23102097
These data demonstrate that CRF triggers increases in intestinal paracellular permeability via mast cell dependent release of TNF-alpha and proteases.PMID:22768175
We identified critical amino acid residues in PRRSV Nsp1alpha and Nsp1beta that are important for TNF-alpha down-regulation and attenuation in vivo.PMID:22699004
Porcine reproductive and respiratory syndrome virus infection impaired TNF-alpha production by inhibiting ERK signaling. pathway.PMID:22497732
Data show that all five molecules, BNP, ICAM-1, TNF-alpha, VCAM-1 and IL-6, quickly and reliably signaled adverse interactions.PMID:21471537
These results suggest that trans-10, cis-12-conjugated linoleic acid can modulate TNF-alpha production and NF-kappa B expression by a PPARgamma-dependent pathway in porcine peripheral blood mononuclear cells.PMID:21205430
Retinal ischemia results in increased expression of TNF-alpha and its receptors (TNF-R1 and TNF-R2).PMID:21152396
increased plasma levels during recovery from cardiac arrest are associated with left ventricle dysfunctionPMID:19642909
Viral non-structural protein 1 suppressed host TNF-alpha promoter by inhibiting NF-kappaB and Sp1 promoter binding activity.PMID:20701940
Exposure of porcine oocytes to an elevated TNF-alpha concentration clearly caused a reduction in their maturation from GV stage to MII stage and increased the proportion of oocytes with abnormal chromosome alignment and cytoskeleton structurePMID:19324350
Survival in the setting of severe, acute trauma/hemorrhagic shock appears to be associated with an immediate increase in serum TNF-alpha.PMID:20027315
These results suggest that TNF-alpha and IL-10, but not IL-6, are involved in the late reparatory phases of the experimental disk lesion.PMID:19605905
Repression of TNF-alpha associated with moderate hypothermia during experimental cardiac surgery is due to inhibition of the mitogen-activated protein kinase p38/activating protein-1 pathway and not to inhibition of NF-kappa B.PMID:16606437
Stenting of coronary arteries was associated with an eight-fold enhancement in TNFalpha expression in injured arterial tissue.PMID:16857205
The effect of EGF on pro-inflammatory cytokines, tumor necrosis factor-alpha (TNF-alpha) and cyclooxygenase-2 (COX-2), levels during wound healing in swine is reported.PMID:17098266
In coronary microembolization, TNF-alpha is responsible for both progressive contractile dysfunction and delayed protection against infarction.PMID:17170366
The data indicate that the development of clinical symptoms of coliform mastitis in the sow is associated with a locally increased proinflammatory cytokine production in response to intramammary Escherichia coli infection.PMID:17903420
the ERK/GEF-H1/Rho/Rho kinase/phospho-MLC pathway is the mechanism mediating TNF-alpha-induced elevation of tubular epithelial permeability, which in turn might contribute to kidney injuryPMID:19261619
Data show that cysteine significantly reduced the expression of pro-inflammatory cytokines, including TNF-alpha, IL-6, IL-12p40, IL-1beta, and resulted in increased expression of the apoptosis initiator caspase-8 and bcl2L1.PMID:19520150
TNF-alpha inhibits adipogenesis through stabilization of beta-catenin protein in porcine preadipocytes.PMID:19558791
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.