Recombinant Pig Tumor necrosis factor (TNF)

Code: CSB-CF023955PI
Size:
20μg
20μg100μg
US$4230
Quantity:
Express system: in vitro E.coli expression system
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
TNF
Uniprot NO.
Species
Sus scrofa (Pig)
Source
in vitro E.coli expression system
Expression Region
1-232
Target Protein Sequence
MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Gene References into Functions
  1. these findings provide the direct evidence that ADAM17 cleaves porcine TNFalpha, which represents a new view for identifying potential therapeutic targets in anti-porcine reproductive and respiratory syndrome virus therapy PMID:26724939
  2. TMZ pretreatment effectively reduced the myocardial damage caused by CME via inhibiting the PDCD4/NF-kappaB/ TNF-alpha pathway in cardiomyocytes. PMID:28683436
  3. TNF-alpha, secreted from activated Monocytes, mediates the downregulation of OTX2 and essential retinal pigment epithelium genes. PMID:27660103
  4. TNF-alpha induced MMP-13 expression by condylar cells might be involved in the degradation of the juvenile condyle. PMID:27618228
  5. TNF-alpha was able to promote theca interna cell proliferation. Our results suggest that TNF-alpha might play a role in hyperandrogenism, cortex thickness, and the increased ovary volume observed in polycystic ovaries. PMID:27125399
  6. This study showed that the -791(C-->T) mutation of the TNF-alpha gene could be considered an important potential genetic marker of enterotoxigenic Escherichia coli F18 resistance. PMID:27408333
  7. Both Nsp1beta and Nsp11 of porcine reproductive and respiratory syndrome virus were demonstrated to be responsible for the inhibitory effect on TNF-alpha production in pulmonary alveolar macrophages. PMID:25708177
  8. Study presents evidence demonstrating a single species of exotoxin ApxI, derived from A. pleuropneumoniae serotype 10, induces the expression and production of proinflammatory cytokines IL-1beta, IL-8 and TNF-alpha in porcine alveolar macrophages. PMID:21314908
  9. the role of miR-181a in adipocyte differentiation by regulation of TNF-alpha PMID:24098322
  10. The NOS inhibitor, L-NMMA, significantly suppressed the combined effects of HT and CORM-2 on TNFalpha-triggered NFkappaBp65 phosphorylation as well as decreased cell viability. PMID:24066302
  11. High-volume hemofiltration improves hemodynamics and heart dysfunction in septic shock pigs, which may be attributed to reduction of TNF-alpha in myocardium but not in circulation. PMID:22994292
  12. Basal lipogenesis was not affected by tumor necrosis factor alpha (TNFalpha) treatment; however, insulin stimulated lipogenesis was reduced by TNFalpha. Interleukin 6 and TNFalpha gene expression were acutely (2-4 h) stimulated by exogenous TNFalpha treatment. PMID:23090779
  13. In swine, IL-8, TNF-ALPHA, INOS AND MIP-1BETA were increased during mechanical ventilation in a time-related fashion. PMID:23102097
  14. These data demonstrate that CRF triggers increases in intestinal paracellular permeability via mast cell dependent release of TNF-alpha and proteases. PMID:22768175
  15. We identified critical amino acid residues in PRRSV Nsp1alpha and Nsp1beta that are important for TNF-alpha down-regulation and attenuation in vivo. PMID:22699004
  16. Porcine reproductive and respiratory syndrome virus infection impaired TNF-alpha production by inhibiting ERK signaling. pathway. PMID:22497732
  17. Data show that all five molecules, BNP, ICAM-1, TNF-alpha, VCAM-1 and IL-6, quickly and reliably signaled adverse interactions. PMID:21471537
  18. These results suggest that trans-10, cis-12-conjugated linoleic acid can modulate TNF-alpha production and NF-kappa B expression by a PPARgamma-dependent pathway in porcine peripheral blood mononuclear cells. PMID:21205430
  19. Retinal ischemia results in increased expression of TNF-alpha and its receptors (TNF-R1 and TNF-R2). PMID:21152396
  20. increased plasma levels during recovery from cardiac arrest are associated with left ventricle dysfunction PMID:19642909
  21. Viral non-structural protein 1 suppressed host TNF-alpha promoter by inhibiting NF-kappaB and Sp1 promoter binding activity. PMID:20701940
  22. Exposure of porcine oocytes to an elevated TNF-alpha concentration clearly caused a reduction in their maturation from GV stage to MII stage and increased the proportion of oocytes with abnormal chromosome alignment and cytoskeleton structure PMID:19324350
  23. Survival in the setting of severe, acute trauma/hemorrhagic shock appears to be associated with an immediate increase in serum TNF-alpha. PMID:20027315
  24. These results suggest that TNF-alpha and IL-10, but not IL-6, are involved in the late reparatory phases of the experimental disk lesion. PMID:19605905
  25. Repression of TNF-alpha associated with moderate hypothermia during experimental cardiac surgery is due to inhibition of the mitogen-activated protein kinase p38/activating protein-1 pathway and not to inhibition of NF-kappa B. PMID:16606437
  26. Stenting of coronary arteries was associated with an eight-fold enhancement in TNFalpha expression in injured arterial tissue. PMID:16857205
  27. The effect of EGF on pro-inflammatory cytokines, tumor necrosis factor-alpha (TNF-alpha) and cyclooxygenase-2 (COX-2), levels during wound healing in swine is reported. PMID:17098266
  28. In coronary microembolization, TNF-alpha is responsible for both progressive contractile dysfunction and delayed protection against infarction. PMID:17170366
  29. The data indicate that the development of clinical symptoms of coliform mastitis in the sow is associated with a locally increased proinflammatory cytokine production in response to intramammary Escherichia coli infection. PMID:17903420
  30. the ERK/GEF-H1/Rho/Rho kinase/phospho-MLC pathway is the mechanism mediating TNF-alpha-induced elevation of tubular epithelial permeability, which in turn might contribute to kidney injury PMID:19261619
  31. Data show that cysteine significantly reduced the expression of pro-inflammatory cytokines, including TNF-alpha, IL-6, IL-12p40, IL-1beta, and resulted in increased expression of the apoptosis initiator caspase-8 and bcl2L1. PMID:19520150
  32. TNF-alpha inhibits adipogenesis through stabilization of beta-catenin protein in porcine preadipocytes. PMID:19558791

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.
Protein Families
Tumor necrosis factor family
Database Links

UNIGENE: Ssc.100

KEGG: ssc:397086

STRING: 9823.ENSSSCP00000001491

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products