Tnfrsf17; Bcm; Bcma; Tumor necrosis factor receptor superfamily member 17; B-cell maturation protein; CD antigen CD269
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-185
Target Protein Sequence
MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Gene References into Functions
high affinity antibody blocks the binding of the native ligands APRIL and BAFF to BCMA. This finding is rationalized by the high resolution crystal structure of the Fab fragment in complex with the extracellular domain of BCMAPMID:25953704
Elimination of B lymphocyte stimulator receptor 3 (BR-3) and BCMA inhibits the development of SLE in NZM mice.PMID:25989238
we have identified a novel role for BCMA to control excess BAFF production in murine lupus through restraining the accumulation of BAFF-producing neutrophils.PMID:25010693
Heteromers consisting of one BAFF and two APRIL bind to receptor TACI, BCMA but not to BAFFR.PMID:25953898
BCMA is dispensable for the development of SLE in NZM mice. BAFF-BCMA interactions contribute to SLE.PMID:23334904
Study reveals that BCMA works to control B cell homeostasis and self-tolerance in systemic autoimmunity.PMID:21536804
Blimp-1 is a positive regulator of the expression of BCMA gene in mouse plasma cells.PMID:20339926
The 5'-flanking sequence from -820 to +145 bp of BCMA is of promoter activity.PMID:18687216
A vital role of BCMA in bone marrow plasma cell survival.PMID:14707116
B cell maturation antigen, the receptor for a proliferation-inducing ligand and B cell-activating factor of the TNF family, induces antigen presentation in B cells.PMID:16116167
Review. APRIL interactions with BCMA likely govern memory B cell populations.PMID:16919470
Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation.PMID:16931039
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type III membrane protein.
Tissue Specificity
Detected in spleen, thymus, bone marrow and heart, and at lower levels in kidney and lung.