Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17)

Code: CSB-CF023974MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3879

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Tnfrsf17

Uniprot NO.

O88472

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-185

Target Protein Sequence

MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

Gene References into Functions

high affinity antibody blocks the binding of the native ligands APRIL and BAFF to BCMA. This finding is rationalized by the high resolution crystal structure of the Fab fragment in complex with the extracellular domain of BCMA PMID:25953704
Elimination of B lymphocyte stimulator receptor 3 (BR-3) and BCMA inhibits the development of SLE in NZM mice. PMID:25989238
we have identified a novel role for BCMA to control excess BAFF production in murine lupus through restraining the accumulation of BAFF-producing neutrophils. PMID:25010693
Heteromers consisting of one BAFF and two APRIL bind to receptor TACI, BCMA but not to BAFFR. PMID:25953898
BCMA is dispensable for the development of SLE in NZM mice. BAFF-BCMA interactions contribute to SLE. PMID:23334904
Study reveals that BCMA works to control B cell homeostasis and self-tolerance in systemic autoimmunity. PMID:21536804
Blimp-1 is a positive regulator of the expression of BCMA gene in mouse plasma cells. PMID:20339926
The 5'-flanking sequence from -820 to +145 bp of BCMA is of promoter activity. PMID:18687216
A vital role of BCMA in bone marrow plasma cell survival. PMID:14707116
B cell maturation antigen, the receptor for a proliferation-inducing ligand and B cell-activating factor of the TNF family, induces antigen presentation in B cells. PMID:16116167
Review. APRIL interactions with BCMA likely govern memory B cell populations. PMID:16919470
Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation. PMID:16931039