Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17)

Code: CSB-CF023974MO
Size:
20μg
20μg100μg
US$3879
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Tnfrsf17
Uniprot NO.
Alternative Names
Tnfrsf17; Bcm; Bcma; Tumor necrosis factor receptor superfamily member 17; B-cell maturation protein; CD antigen CD269
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-185
Target Protein Sequence
MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTVLWIFLGLTLVLSLALFTISFLLRKMNPEALKDEPQSPGQLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAMEEGATILVTTKTGDYGKSSVPTALQSVMGMEKPTHTR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.
Gene References into Functions
  1. high affinity antibody blocks the binding of the native ligands APRIL and BAFF to BCMA. This finding is rationalized by the high resolution crystal structure of the Fab fragment in complex with the extracellular domain of BCMA PMID:25953704
  2. Elimination of B lymphocyte stimulator receptor 3 (BR-3) and BCMA inhibits the development of SLE in NZM mice. PMID:25989238
  3. we have identified a novel role for BCMA to control excess BAFF production in murine lupus through restraining the accumulation of BAFF-producing neutrophils. PMID:25010693
  4. Heteromers consisting of one BAFF and two APRIL bind to receptor TACI, BCMA but not to BAFFR. PMID:25953898
  5. BCMA is dispensable for the development of SLE in NZM mice. BAFF-BCMA interactions contribute to SLE. PMID:23334904
  6. Study reveals that BCMA works to control B cell homeostasis and self-tolerance in systemic autoimmunity. PMID:21536804
  7. Blimp-1 is a positive regulator of the expression of BCMA gene in mouse plasma cells. PMID:20339926
  8. The 5'-flanking sequence from -820 to +145 bp of BCMA is of promoter activity. PMID:18687216
  9. A vital role of BCMA in bone marrow plasma cell survival. PMID:14707116
  10. B cell maturation antigen, the receptor for a proliferation-inducing ligand and B cell-activating factor of the TNF family, induces antigen presentation in B cells. PMID:16116167
  11. Review. APRIL interactions with BCMA likely govern memory B cell populations. PMID:16919470
  12. Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation. PMID:16931039

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Tissue Specificity
Detected in spleen, thymus, bone marrow and heart, and at lower levels in kidney and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products