Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2)

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2)

Code: CSB-CF002208MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4747

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Asgr2

Uniprot NO.

P24721

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-301

Target Protein Sequence

MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLSLLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Gene References into Functions

ASGP-R2 mediates the clearance of glycoproteins that bear oligosaccharides terminating with Siaalpha2,6Gal and thereby helps maintain the relative concentrations of these glycoproteins in the blood. PMID:19075021

Hide All

Subcellular Location

Membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed exclusively in hepatic parenchymal cells.

Database Links

UNIGENE: Mm.1357

KEGG: mmu:11890

STRING: 10090.ENSMUSP00000099632

Promotions