Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Asgr2; Asgr-2; Asialoglycoprotein receptor 2; ASGP-R 2; ASGPR 2; Hepatic lectin 2; HL-2; mHL-2
Species
Mus musculus (Mouse)
Expression Region
80-301aa
Target Protein Sequence
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
The process of expressing the recombinant mouse Asgr2 protein in the E.coli requires the recombinant DNA gene formed by the integration of encoding gene for the 80-301aa of the mouse Asgr2 protein and N-terminal 10xHis-SUMO tag and C-terminal Myc tag sequence, the expression vector that the recombinant DNA gene inserts into, the E.coli that provided the necessary macromolecules and components for transcription and translation of the cloned expression vector. After isolation and purification, this N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged recombinant Asgr2 protein was obtained. This recombinant Asgr2 protein is characterized by high purity (>90%, SDS-PAGE). This Asgr2 protein ran along the gel to the band of approximately 45 kDa molecular weight.
Asialoglycoprotein receptor 2 (also abbreviated as ASGPR2),a subunit of the Asialoglycoprotein receptor (ASGPR), is a protein encoding by a gene named Asgr2 in mouse and a gene named ASGR2 in human. Asialoglycoprotein receptor (ASGPR) is a receptor specifically expressed by hepatocytes, and it is a highly efficient endocytic receptor. The main function of ASGPR is to remove asialoglycoprotein, apoptotic cells and lipoproteins in the blood circulation system. In addition to asialoceruloplasmin, ASGPR can also bind to many other asialoglycoproteins, such as erythropoietin, interferon, thyroglobulin, transferrin, hepatoglobulin, fetuin, prothrombin and so on.
