Home
Product
Protein
Transmembrane Proteins
Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3)

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3)

Code: CSB-CF015551MOV

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3677

Quantity:

Express system: in vitro E.coli expression system

Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

NCR3

Uniprot NO.

P61483

Alternative Names

NCR3; Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein; NK-p30; NKp30; CD antigen CD337

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

in vitro E.coli expression system

Expression Region

19-176

Target Protein Sequence

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGTVLLLRAGFYAVSFLSVAVGSTLYYQGKCHCHMGTHCHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Natural cytotoxicity receptor (NCR) family

Database Links

UNIGENE: Mfa.6651

KEGG: mcf:102133932

Promotions