All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3)

CSB-CF015551MOV
Size:
20μg
20μg100μg
US$3677
Quantity:
Express system: in vitro E.coli expression system
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
NCR3
Uniprot NO.
P61483
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
in vitro E.coli expression system
Expression Region
19-176
Target Protein Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGTVLLLRAGFYAVSFLSVAVGSTLYYQGKCHCHMGTHCHS
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Protein FAQs
Datasheet & COA
Please contact us to get it.
Description

Related Products

See all products about NCR3 >>

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Natural cytotoxicity receptor (NCR) family
Database Links

UNIGENE: Mfa.6651

KEGG: mcf:102133932

Promotions
Reward For Reviews
Free trial size antibodies
Contact Us

  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
B7-H6 (NCR3LG1): A Key Ligand of NK Cell Immune Checkpoints Reshaping the Landscape of Tumor ImmunotherapyImmune Battlefield's "Scout": Decoding the NCR3 TargetCUSABIO's Five Expression SystemsHow to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchApproaches to Determinate Protein ConcentrationExploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing ItWhat Is Protein Characterization: Definition, Examples, Methods, and TechniquesProtein Tags: A Comprehensive Overview
Related pathways
Natural killer cell mediated cytotoxicityCell markers
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
support@cusabio.com
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
▲ Select 0 Products