Abbreviation
Recombinant Cynomolgus monkey NCR3 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3 at 2 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3LG1(CSB-MP4942MOVd9). The EC50 is 7.429 to 11.19 ng/mL.
Alternative Names
Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein (NK-p30;NKp30); CD337; NCR3
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
19-135aa
Target Protein Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3 at 2 μg/ml on an Nickel Coated plate can bind Macaca fascicularis NCR3LG1(CSB-MP4942MOVd9). The EC50 is 7.429 to 11.19 ng/mL.
Description
NKp30 (NCR3) is a key activating receptor on natural killer cells that recognizes stress-induced ligands on tumor and infected cells, making it a critical target for understanding NK cell-mediated cytotoxicity in primate models. This recombinant protein, spanning the extracellular domain (aa 19–135), demonstrates quantified binding to its cognate ligand NCR3LG1 with an EC50 of 7.4–11.2 ng/mL in functional ELISA, providing a validated basis for ligand-receptor interaction studies and competitive inhibition assays in cynomolgus macaque immunology research. Mammalian expression preserves the native glycosylation and disulfide bonding patterns essential for proper receptor folding, supporting its use in therapeutic antibody epitope mapping, blocking antibody screening, and affinity characterization by surface plasmon resonance or biolayer interferometry. The protein meets quality thresholds commonly required for functional assays, with >95% purity by SDS-PAGE and endotoxin levels <1.0 EU/μg, aligning with standards expected in immune checkpoint research and drug discovery programs targeting NK cell activation pathways.
