Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8)

Code: CSB-CF023996HU
Size:
20μg
20μg100μg
US$4245
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
TNFSF8
Uniprot NO.
Alternative Names
TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-234
Target Protein Sequence
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Gene References into Functions
  1. circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID:24447865
  2. TNFSF8 is an important leprosy T1R susceptibility gene. PMID:25320285
  3. The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID:24676358
  4. The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID:22033252
  5. Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID:21480186
  6. a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID:21292647
  7. capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID:11728464
  8. Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID:16964309
  9. CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID:19208589
  10. Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID:19657367

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

HGNC: 11938

UNIGENE: Hs.494901

KEGG: hsa:944

STRING: 9606.ENSP00000223795

OMIM: 603875

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products