Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

In Stock
Code: CSB-MP023996HU1c9
Size:
20ug
20ug100ug1mg
US$136
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: N-terminal hFc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human TNFSF8 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.
Target Names
TNFSF8
Uniprot NO.
Alternative Names
TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
63-234aa
Target Protein Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.8 kDa
Protein Length
Partial
Tag Info
N-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.
Description

CD30 ligand (TNFSF8) drives NF-κB signaling through CD30 engagement on activated T and B cells, making it a critical tool for dissecting lymphocyte activation and Hodgkin lymphoma biology. This recombinant human CD30L, spanning residues 63–234 with an N-terminal hFc tag, demonstrates potent receptor binding with an EC50 of 4.169–6.360 ng/ml against immobilized CD30 in functional ELISA, supporting its use as a coating antigen for antibody screening, a positive control in CD30/CD30L interaction assays, and a stimulus in cell-based activation or proliferation studies using primary lymphocytes. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive immune cell experiments, while purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for in vivo tumor models and NF-κB pathway signaling studies. The hFc fusion format also facilitates straightforward detection and crosslinking in functional assays requiring receptor clustering.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Gene References into Functions
  1. circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID:24447865
  2. TNFSF8 is an important leprosy T1R susceptibility gene. PMID:25320285
  3. The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID:24676358
  4. The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID:22033252
  5. Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID:21480186
  6. a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID:21292647
  7. capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID:11728464
  8. Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID:16964309
  9. CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID:19208589
  10. Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID:19657367

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

HGNC: 11938

UNIGENE: Hs.494901

KEGG: hsa:944

STRING: 9606.ENSP00000223795

OMIM: 603875

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products