HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The results suggest that TROP2 expression could be an effective prognostic biomarker for oral squamous cell carcinomaPMID:30098828
TROP-2, SLP-2 and CD56 were effective diagnostic markers for PTC, especially when they were combined to use.PMID:29951933
Trop2 has a potential role in the promotion of EMT in BC.PMID:29901160
these results suggested that TROP2 may promote osteosarcoma cell proliferation and migration via PI3K/AKT signaling and may serve as a novel treatment target for osteosarcoma .PMID:29845216
TACSTD2 downregulation is associated with hepatocellular carcinoma.PMID:29538454
findings demonstrate that a membranous TROP-2 staining pattern is highly specific for PTC, which may serve as a potential diagnostic marker aiding in the accurate classification of morphologically equivocal thyroid follicular-patterned lesionsPMID:26862947
TROP2 promoted the proliferation, migration and metastasis of gallbladder cancer cells by regulating PI3K/AKT pathway and inducing EMT.PMID:28423362
The results from clinical specimens showed that Trop2 expression correlated with MMP2 expression in primary thyroid cancer. The current study suggests that elevated expression of Trop2 may represent an important molecular hallmark that is biologically and clinically relevant to the progression of thyroid cancer.PMID:28709407
these results suggest a differential role for TROP2 in different lung cancer subtypesPMID:28404926
Results show that TROP2 expression is up-regulated in gastric tumor and its co-expression with AREG protein is associated with TNM stage, tumor size, lymph node metastases, and distant metastases.PMID:28256068
Our findings indicate that the expression of Trop-2 is a stringent predictor of tumor response to AKT inhibitors. They also support the identification of target-activatory pathways, as efficient predictors of response in precision cancer therapy.PMID:27022065
Findings suggest that high TROP2 expression identifies distinct cell sub-populations in androgen-sensitive and androgen-independent prostate tumors and that it may be a predictive biomarker for prostate cancer treatment response in androgen-sensitive tumors.PMID:27283984
TROP2 may play a crucial role in COPD by affecting basal cells function and thus airway remodeling through increased basal cells hyperplasiaPMID:27887617
TROP2 was overexpressed specifically in the majority of epithelial ovarian cancer and may be a novel prognostic biomarkerPMID:27127000
we compared the diagnostic value of TROP-2 expression in distinguishing between benign and malignant thyroid lesions to those of HBME-1, CK19 and galectin-3PMID:28547974
TROP-2 membranous staining is a very sensitive and specific marker for the classic and tall cell variants of papillary thyroid carcinoma, and for papillary microcarcinomas , with high overall specificity for papillary thyroid carcinomaPMID:27311870
The results suggested that trop2 facilitated neovascularization of non-small-cell lung cancer via activating ERK1/2 signaling pathway.PMID:28345466
We identified a homozygous TACSTD2 missense mutation, c.551A>G, p.(Tyr184Cys), in the affected family members. Both parents were heterozygous for the mutation, and unaffected siblings were either heterozygous or homozygous wild-type for this allele.PMID:27227392
Our results expand the mutational spectrum of TACSTD2 in patients with gelatinous drop-like corneal dystrophy (GDLD).PMID:27149532
Trop2 expression was higher in GC tissues than in neighboring non-tumor tissues. Increased Trop2 protein levels in GC were associated with increased differentiation, tumor node metastasis stage, tumor size, lymph node metastasis, distant metastasis, and H. pylori infection.PMID:26716416
Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers.PMID:26101915
TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma.PMID:26626643
TROP-2 is specifically expressed in papillary thyroid carcinoma.PMID:26481593
overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinomaPMID:26617817
Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samplesPMID:26600538
TROP-2 can be used as well as HBME-1 in thyroid cytology to detect PTC.PMID:25164548
Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease.PMID:26773504
TROP2 protein is expressed at high levels in the colon cancer tissues.PMID:26059528
TACSTD2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival.PMID:24764155
The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype.PMID:26115884
These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic targetPMID:25779928
This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs.PMID:25550831
Trop2 loss triggers sensitivity to anti-ErbB3 antibodies, which results in reduced proliferation and tumorigenic growth of Trop2 negative head and neck squamous cell cancer cells.PMID:25238142
studies have begun to identify the mechanisms underlying TROP2's functions, including regulated intramembrane proteolysis or specific interactions with integrin b1 and claudin proteins.PMID:25523132
we demonstrate that the Trop-2 activation states are critical determinants of tumor progression and are powerful indicators of breast cancer patients survival.PMID:24824621
Inhibition of Tacstd2 expression significantly inhibited chemotherapeutic reagent-induced apoptosis, and TACSTD2 regulated apoptotic gene expression through P63 containing the transactivation domain (TAp63).PMID:24651436
Trop2 is important in proliferation and apoptosis regulation in CaSki cells, which may become a novel target for cervical cancer treatment.PMID:24816726
Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway.PMID:24086649
miR-125b-1 causes mitogen-activated protein kinase pathway dysfunction through regulation of TACSTD2 expression.PMID:23416980
The results of this study suggested that the TROP2 correlated with malignancy, proliferation and angiogenesis in human gliomasPMID:23397225
TROP2 gene expression can be used as an independent prognostic indicator for squamous cell carcinoma of the larynx.PMID:22987366
Used the Sf9 cells to express the Trop2 ectodomain (Trop2EC) in two forms - wt glycosylated (gTrop2EC) and mutant non-glycosylated form (Trop2EC(Delta/N)). Recombinant protein was purified and structure studied.PMID:23872121
Trop2 expression reflects a more malignant phenotype and may serve as an unfavorable prognostic factor for extranodal NK/T cell lymphoma, nasal typePMID:23979406
The cells exhibited a low epithelial barrier function as well as decreased expression of tight-junction-related proteins claudin 1 and 7.PMID:23868985
show that Trop-2 enhances directional prostate cancer cell migration, through modulation of Rac1 GTPase activityPMID:23536555
Network hubs and interacting partners are co-expressed with Trop-2 in primary human tumours, supporting a role of this signalling network in cancer growth.PMID:22562244
study characterized the expression of TACSTD2 in invasive ductal breast cancer(IDC) and adjacent non-malignant tissues; studies demonstrated that the high expression of TACSTD2 correlates with a poor prognosis in IDCPMID:23031786
Our data support a model where above-baseline expression of wild-type Trop-2 is a key driver of human cancer growth.PMID:22349828
High expression of TROP2 was associated with stage stage IIb colon cancer.PMID:23055188
More than 90% of Gelatinous drop-like corneal dystrophy (GDLD) patients possessed the same haplotype with a Q118X mutation in TACSTD2.PMID:23038033