Abbreviation
Recombinant Human TACSTD2 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Alternative Names
TACSTD2; GA733-1; M1S1; TROP2; Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
27-274aa
Target Protein Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time maybe differs from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Trop-2 (TACSTD2) has emerged as a high-value therapeutic target in oncology, and this recombinant human construct covering residues 27–274 with a C-terminal hFc1 tag provides validated biological activity for functional studies. In a cell-based assay using U937 cells, the protein demonstrates an EC50 of 190.2–298.6 ng/mL, confirming its suitability for functional cell assays, antibody development screening, and receptor-binding studies. Mammalian cell expression preserves native glycosylation patterns critical for Trop-2's extracellular domain folding and ligand interactions, making this preparation appropriate for use as an immunogen or as a standard in antibody characterization workflows. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and supports use in animal model studies where endotoxin contamination could confound results.
