Purity
Greater than 95% as determined by SDS-PAGE.
Alternative Names
Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1
Species
Homo sapiens (Human)
Expression Region
31-274aa
Target Protein Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Trop-2 overexpression in epithelial cancers drives tumor progression through calcium-dependent signaling pathways, making validated extracellular domain reagents essential for therapeutic antibody development and mechanistic studies. This biotinylated protein spanning residues 31–274 demonstrates robust antibody binding in functional ELISA with an EC50 of 11.22–13.11 ng/mL and exhibits a 2.52 nM affinity constant in surface plasmon resonance assays, confirming that the mammalian expression system preserves native epitope presentation required for antibody validation workflows. The quantitative binding data supports use in screening therapeutic antibody candidates, epitope mapping studies, and cell-based assays investigating Trop-2-mediated tumor cell adhesion and migration. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for functional immunoassays and SPR-based affinity measurements.
