Recombinant Human Relaxin-3 receptor 2 (RXFP4)

Code: CSB-CF851553HU
Size:
20μg
20μg100μg
US$5293
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
RXFP4
Uniprot NO.
Alternative Names
RXFP4; GPCR142; GPR100; RLN3R2; Relaxin-3 receptor 2; RLN3 receptor 2; G-protein coupled receptor 100; G-protein coupled receptor GPCR142; Insulin-like peptide INSL5 receptor; Relaxin family peptide receptor 4
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-374
Target Protein Sequence
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAV LWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTA TVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFG VEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQD SRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESR PSTLLTNLDRGTPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation.
Gene References into Functions
  1. The results confirmed the presence of RXFP4 in human spermatozoa, which localized in the neck and midpiece of sperm. PMID:28986276
  2. The role of these four INSL5 determinants in distinguishing RXFP4 from RXFP3. PMID:27404393
  3. analysis of the interaction mechanism of INSL5 with its receptor RXFP4 PMID:28274616
  4. Relaxin-3 is a high-efficacy agonist at RXFP4 with a comparable signal transduction profile to INSL5. PMID:27888281
  5. The C-terminus of the B-chain of human INSL5 is critical for cognate RXFP4 receptor activity. PMID:26661035
  6. electrostatic interactions between INSL5 and RXFP4 PMID:25043977
  7. Mutant relaxin-3 shows a significant decrease in receptor-activation potency towards RXFP4. PMID:24802387
  8. relaxin-3/INSL7 is a ligand for GPCR142 [GPCR142] PMID:14522967
  9. Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142. PMID:15465925
  10. INSL5 is an endogenous ligand for GPCR142 PMID:15525639
  11. the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation. PMID:18582868

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon.
Database Links

HGNC: 14666

UNIGENE: Hs.449914

KEGG: hsa:339403

STRING: 9606.ENSP00000357301

OMIM: 609043

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products