Recombinant Human Relaxin-3 receptor 2 (RXFP4)

Code: CSB-CF851553HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5293

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

RXFP4

Uniprot NO.

Q8TDU9

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-374

Target Protein Sequence

MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAV LWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTA TVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFG VEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQD SRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESR PSTLLTNLDRGTPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation.

Gene References into Functions

The results confirmed the presence of RXFP4 in human spermatozoa, which localized in the neck and midpiece of sperm. PMID:28986276
The role of these four INSL5 determinants in distinguishing RXFP4 from RXFP3. PMID:27404393
analysis of the interaction mechanism of INSL5 with its receptor RXFP4 PMID:28274616
Relaxin-3 is a high-efficacy agonist at RXFP4 with a comparable signal transduction profile to INSL5. PMID:27888281
The C-terminus of the B-chain of human INSL5 is critical for cognate RXFP4 receptor activity. PMID:26661035
electrostatic interactions between INSL5 and RXFP4 PMID:25043977
Mutant relaxin-3 shows a significant decrease in receptor-activation potency towards RXFP4. PMID:24802387
relaxin-3/INSL7 is a ligand for GPCR142 [GPCR142] PMID:14522967
Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142. PMID:15465925
INSL5 is an endogenous ligand for GPCR142 PMID:15525639
the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation. PMID:18582868