QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
Gene References into Functions
In a replication study of the association between the prolactin receptor gene intron C/T polymorphism (rs37389) and recurrent miscarriage, no association was found.PMID:28980840
Low PRLR expression is associated with Triple Negative Breast Cancer.PMID:27480353
These results illustrate promising antitumor activity against PRLR-positive breast cancer xenografts and support the evaluation of anti-PRLR antibody-drug conjugate as potential therapeutic agents in breast cancer.PMID:28377489
Prl receptor is expressed at different levels in the majority of glioblastoma multiforme tumors. Prolactin stimulation resulted in increased STAT5 phosphorylation and increased cellular invasion.PMID:27788487
PRLRI146L and PRLRI176V variants are not associated with breast cancer or multiple breast fibroadenomas risk.PMID:27575941
This study identified 4 PRLR variations (p.Ile76Val, p.Ile146Leu, p.Glu108Lys and p.Glu554Gln) in 16 Sporadic Prolactinoma in Humans.PMID:26641246
results highlight PRLR as an independent predictor of favorable prognosis in human breast cancerPMID:26317306
Two markers for the PRL peptide gene and three markers for the prolactin receptor (PRLR) gene were genotyped.PMID:26513615
The prolactin receptor is constitutively expressed on regulatory T and effector T cells in systemic lupus erythematosus patients, and this expression is higher than in healthy individuals.PMID:26844452
There is a possible role for PRLR in the progression of cervical cancer.PMID:24990775
Study shows that position 146 plays a central role in directing intrinsic properties of the PRLR, including extracellular domain folding, PRL-responsiveness, and ligand-independent activity of the receptor.PMID:25524456
Data suggest that (1) cell membrane/lipid bilayer binding of PRLR and (2) tyrosine phosphorylation of PRLR intracellular domain are independent.PMID:25846210
long PRLR plays an important role in breast cancer metastasis.PMID:26095602
a residue quartet in the extracellular membrane proximal domain of the homodimeric cytokine receptor prolactin receptor is a key regulator of intracellular signaling discriminationPMID:25784554
PRL induced transient signaling pathways in neurons and modulated ion channels. [review]PMID:24758841
exposure to prolactin increases TNF-alpha release from CD14(+) monocytes of rheumatoid arthritis patients, which can be abolished by PRLR gene silencing or treating with MAPK inhibitor.PMID:24997655
High MFAB expression is associated with testicular germ cell tumor and glioblastomas.PMID:24391856
Negative/low expression is associated with poorly differentiated and larger breast tumors in PolandPMID:24249584
Major changes in prolactin receptor conformation and dimerization affinity are triggered by single mutations in critical regions of D1.PMID:24735798
PRL-R attenuation post-transcriptionally increased ZnT2 abundance and redistributed intracellular Zn pools into lysosomes and mitochondria.PMID:24333596
Hypertrimethylation on H3K27 of the p53 gene promoter region due to elevated expression of DeltaS2 PRLR by alternative splicing of the pre-mRNA in its full-length form might serve as a new mechanism underlying prostate cancerPMID:24032713
Data suggest that signal transduction via prolactin and prolactin receptor plays role in trophoblast cell migration and invasion; PRLR is expressed by extravillous cytotrophoblasts and first-trimester placental bed tissue.PMID:23849393
PRL-induced transient signaling in sensory neurons is governed by PI3K or PKCepsilon, mediated via the PRLR-S isoform, and transient effects mediated by PRLR-S are inhibited by presence of PRLR-L in these cells.PMID:24142695
SNPs of the PRLR gene 5' UTR and promoter region are associated with increased risk for gestational diabetes in a population of Chilean subjects.PMID:23651351
Thus, the familial hyperprolactinemia appears to be due to a germline, loss-of-function mutation in PRLR, resulting in prolactin insensitivity.PMID:24195502
Results demonstrate a novel function for hepatic PRLR in the regulation of insulin sensitivity and provide important insights concerning the nutritional regulation of PRLR expression.PMID:23775766
Our data suggest that prolactin receptor presence meaningfully affects growth hormone receptor use in breast cancer cells.PMID:23192981
The prolactin receptor transactivation domain is associated with steroid hormone receptor expression and malignant progression of breast cancerPMID:23159947
Our results indicate no significant association of prolactin and PRLR polymorphisms with clozapine response, tardive dyskinesia diagnosis or its severity in patients with schizophreniaPMID:21305610
can be activated by three sequence-diverse human hormones: prolactin, GH, and placental lactogen [review]PMID:22577091
PRLr isoforms expression and PRLr subcellular localisation are altered in parathyroid tumoursPMID:22606260
The structure of the human prolactin receptor reveals a structural link between the WSXWS motif, hormone binding, and receptor dimerization and we propose it as a general mechanism for class 1 receptor activation.PMID:22325776
PRL signaling through the long form prolactin receptor causes reduced fatty acid oxidation, increased lipid storage, glucose intolerance, and obesity.PMID:21989556
data provide limited support for an association between common variations in PRLR and breast cancer riskPMID:21470416
The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth.PMID:21816901
Our study suggests the prolactin receptor gene is a molecular target that may be important in the pathogenesis and progression of lobular neoplasiaPMID:20658264
Enhanced complex formation of ERalpha dimer with SP1 and C/EBPbeta by E2 has an essential role in the transcriptional activation of the hPRLR gene.PMID:21670145
Data show that cells expressing higher long:short PRLR ratios had increased growth, survival and migration in response to PRL and suggest that PRLR antagonists may be therapeutically beneficial in ovarian cancer.PMID:21775057
Endogenous GH receptor(GHR) and PRLR associate, possibly as a GHR-PRLR heterodimer, in human breast cancer cells and GH signaling in these cells is largely mediated by the PRLR in the context of both PRLR-PRLR homodimers and GHR-PRLR heterodimers.PMID:21310852
The positive correlations in positivity rate between the PRL-R and ER/PR expressions are found only in CerbB-2 positive patients with breast cancer.PMID:20335148
SIRPalpha modulates PRL receptor-associated signaling as a function of integrin occupancy by mediating integrin-PRL receptor cross-talk and contributing to breast cancer biology.PMID:20826546
both Zn(2+) and human PRLr binding influence human PRL conformers in an interdependent fashionPMID:21510945
Functional impact of manipulation on the relative orientation of human prolactin receptor domains.PMID:21591677
Progesterone induces expression of the prolactin receptor gene through cooperative action of Sp1 and C/EBP transcription factorsPMID:21238538
Rabbit antibodies have high titer and could specifically recognize each isoform of PRLR in breast cancer cell lines and human breast carcinoma biopsies.PMID:21144038
Prolactin receptor signaling contributes to the local inflammatory response within the atherosclerotic plaque and thus to atherogenesis.PMID:21068074
Blockade of the PRLR represents a novel treatment for patients with advanced breast or prostate cancer with limited therapeutic options.PMID:20846877
acetylation and deacetylation provide the rheostat-like regulation for the cytokine receptor PRLR in its cytoplasmic loop dimerization and subsequent STAT5 activationPMID:20962278
This study allowed to visualize for the first time the loop L5 spanning PRLR2 residues Thr133-Phe140, revealing its central implication for the three intermolecular interfaces of the 1:2 complex between natural prolactin and two PRLR chains.PMID:20875426
prolactin receptor expression is common in colorectal cancerPMID:20453834
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 7]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Tissue Specificity
Expressed in breast, placenta, kidney, liver and pancreas.