Home
Product
Protein
Transmembrane Proteins
Recombinant Human Probable G-protein coupled receptor 85 (GPR85)

Recombinant Human Probable G-protein coupled receptor 85 (GPR85)

Code: CSB-CF009837HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5263

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPR85

Uniprot NO.

P60893

Alternative Names

GPR85; SREB2; Probable G-protein coupled receptor 85; Super conserved receptor expressed in brain 2

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-370

Target Protein Sequence

MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Orphan receptor.

Gene References into Functions

Risk-associated variants in GPR85 are associated with phenotypes similar to those found in patients with schizophrenia. PMID:22968816
The areas expressing high levels of SREB2 mRNA overlap with brain structures known to possess high levels of plasticity, namely, the hippocampal formation, olfactory system, and supraoptic and paraventricular nuclei. PMID:15893849
Theses data implicate SREB2 as a potential risk factor for psychiatric disorders. PMID:18413613

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Highly expressed in brain and testis. Lower levels in small intestine, placenta and spleen. In brain regions, detected in all regions tested, but somewhat lower levels in the corpus callosum, medulla and spinal cord.

Database Links

HGNC: 4536

UNIGENE: Hs.152009

KEGG: hsa:54329

STRING: 9606.ENSP00000297146

OMIM: 605188

Promotions