Home
Product
Protein
Transmembrane Proteins
Recombinant Human Parathyroid hormone 2 receptor (PTH2R)

Recombinant Human Parathyroid hormone 2 receptor (PTH2R)

Code: CSB-CF018990HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3385

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

PTH2R

Uniprot NO.

P49190

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

27-145

Target Protein Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPC PPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.

Gene References into Functions

expressed in the epidermis in Darier disease PMID:28094886
PTH2R and its ligand TIP39 regulate intracellular calcium and influence keratinocyte differentiation PMID:27000502
Authors report PTH2R as a gene that is disrupted in NSC. The disruption of the PTH2R gene may cause uncontrolled proliferation and differentiation of chondrocytes. PMID:26044810
Variation in the PTH2R gene (Chr2q34, rs897083) may contribute to the age-associated degenerative manifestations that develop at the lumbar spine PMID:24378925
Data suggest role for PTH2R signaling in postnatal growth plate development and subsequent bone mass acquisition; overexpression of human PTH2R in chondrocytes of transgenic mice has key consequences on postnatal development of endochondral skeleton. PMID:23092913
specific interactions within the ligand-receptor bimolecular complex mediate distinct postactivation responses of class II G protein- coupled receptors and provide novel insights into the physiological regulation of PTH2R activity PMID:14988434
The distribution of PTH2R-immunoreactive fibers in viscerosensory brain regions is similar to that reported in mouse and rat suggesting a similar role of the PTH2R in human as in rodents. PMID:18459453
The results demonstrate that TIP39 and the PTH2R are expressed in the brain of primates in locations that suggest involvement in regulation of fear, anxiety, reproductive behaviors, release of pituitary hormones, and nociception. PMID:19401215