Home
Product
Protein
Recombinant Proteins
Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial

Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial

CSB-EP018990HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PTH2R

Uniprot NO.

P49190

Research Area

Neuroscience

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

27-145aa

Target Protein Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Mol. Weight

29.6kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.

Gene References into Functions

expressed in the epidermis in Darier disease PMID:28094886
PTH2R and its ligand TIP39 regulate intracellular calcium and influence keratinocyte differentiation PMID:27000502
Authors report PTH2R as a gene that is disrupted in NSC. The disruption of the PTH2R gene may cause uncontrolled proliferation and differentiation of chondrocytes. PMID:26044810
Variation in the PTH2R gene (Chr2q34, rs897083) may contribute to the age-associated degenerative manifestations that develop at the lumbar spine PMID:24378925
Data suggest role for PTH2R signaling in postnatal growth plate development and subsequent bone mass acquisition; overexpression of human PTH2R in chondrocytes of transgenic mice has key consequences on postnatal development of endochondral skeleton. PMID:23092913
specific interactions within the ligand-receptor bimolecular complex mediate distinct postactivation responses of class II G protein- coupled receptors and provide novel insights into the physiological regulation of PTH2R activity PMID:14988434
The distribution of PTH2R-immunoreactive fibers in viscerosensory brain regions is similar to that reported in mouse and rat suggesting a similar role of the PTH2R in human as in rodents. PMID:18459453
The results demonstrate that TIP39 and the PTH2R are expressed in the brain of primates in locations that suggest involvement in regulation of fear, anxiety, reproductive behaviors, release of pituitary hormones, and nociception. PMID:19401215