Recombinant Human Neurotensin receptor type 2 (NTSR2)

Code: CSB-CF016138HU
Size:
20μg
20μg100μg
US$5562
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
NTSR2
Uniprot NO.
Alternative Names
NTSR2; Neurotensin receptor type 2; NT-R-2; NTR2; Levocabastine-sensitive neurotensin receptor
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-410
Target Protein Sequence
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for the tridecapeptide neurotensin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. We showed that expression levels for NTS and NTSR1 varied, that NTSR2 expression was not detectable and that NTSR3 was consistently expressed in all CRC cell lines examined. PMID:28498396
  2. high expression of NTSR1 is found in clinical NETs and promoter methylation is an important mechanism controlling the differential expression of NTSR1 and silencing of NTSR2 in NET cells PMID:26298774
  3. NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was not expressed in B cell leukemia patient's B-cells, as compared with healthy B cells. PMID:23109725
  4. this study proposes a novel function of NTR2 in the regulation of NTR1 activity. PMID:19968961
  5. NTR2 and NTR3 were upregulated in prostate cancer cells with luminal phenotype (cytokeratin 18+) PMID:20048080
  6. Recycling ability depends on a single tyrosine residue PMID:11801734
  7. ghrelin receptor, neurotensin receptor 2 and GPR39 display an unusually high degree of constitutive activity, determined by an aromatic cluster on the inner face of the extracellular ends of TMs VI and VII PMID:15383539
  8. NTR1 and NTR2 mRNA were not detected in either pituitary adenomas or normal tissue. PMID:18624930

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Neurotensin receptor subfamily, NTSR2 sub-subfamily
Tissue Specificity
Expressed in prostate (at protein level).
Database Links

HGNC: 8040

UNIGENE: Hs.131138

KEGG: hsa:23620

STRING: 9606.ENSP00000303686

OMIM: 605538

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products