Recombinant Human Neuromedin-U receptor 2 (NMUR2)

Code: CSB-CF875632HU

Rate （N/A）
Review （0）

Size:

20ug100ug

US$1620

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: C-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human NMUR2 protein

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

NMUR2

Uniprot NO.

Q9GZQ4

Research Area

Others

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-415aa

Target Protein Sequence

MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.2 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the neuromedin-U and neuromedin-S neuropeptides.

Gene References into Functions

NMU might contribute to progression of NMUR2-positive breast cancer PMID:28423716
polymorphisms in the gene may be useful in identifying women at risk for osteoporosis. PMID:25871004
Study identified a novel NMUR2 splice variant lacking the third exon and able to form heteromeric complexes with NMUR1 and NMUR2 without Neuromedin U (NMU). Its expression can block NMU signaling suppressing then ovarian cancer cells proliferation. PMID:26317338
A cell-based reporter gene assay has been developed and used for the screening of the human NMU2R agonist. PMID:16781063

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the gastrointestinal trac

Database Links

HGNC: 16454

UNIGENE: Hs.731911

KEGG: hsa:56923

STRING: 9606.ENSP00000255262

OMIM: 605108

Promotions