Abbreviation
Recombinant Human CD37 protein
Alternative Names
CD37; TSPAN26; Leukocyte antigen CD37; Tetraspanin-26; Tspan-26; CD antigen CD37
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Target Protein Sequence
MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human CD37 (TSPAN26) protein is a key player in the realm of immunology research. CD37, also known as leukocyte antigen CD37, Tetraspanin-26 (Tspan-26), is an essential component involved in various immune processes. This recombinant protein is synthesized using an advanced in vitro E.coli expression system, ensuring its high quality and functionality. It encompasses the full length of the CD37 protein, spanning amino acids 1 to 281, providing a comprehensive understanding of its biological activities and interactions.
To facilitate easy detection and purification, the Recombinant Human CD37 features an N-terminal 10xHis tag. This tag enhances its solubility and simplifies downstream applications. With a purity level of greater than 85% as determined by SDS-PAGE, you can trust in the reliability and consistency of this protein for your research. Whether you prefer liquid or lyophilized powder form, we offer both options, providing flexibility in storage and experimental setups. Explore the vast potential of the Recombinant Human CD37 protein in advancing your immunological investigations and gaining deeper insights into immune responses and cell signaling pathways.
