Recombinant Human Leukocyte antigen CD37 (CD37)

In Stock

Code: CSB-CF004928HU

Rate （N/A）
Review （0）

Size:

20ug100ug

US$1040

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human CD37 protein

Target Names

CD37

Uniprot NO.

P11049

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-281

Target Protein Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

This Recombinant Human CD37 (TSPAN26) protein is a key player in the realm of immunology research. CD37, also known as leukocyte antigen CD37, Tetraspanin-26 (Tspan-26), is an essential component involved in various immune processes. This recombinant protein is synthesized using an advanced in vitro E.coli expression system, ensuring its high quality and functionality. It encompasses the full length of the CD37 protein, spanning amino acids 1 to 281, providing a comprehensive understanding of its biological activities and interactions.

To facilitate easy detection and purification, the Recombinant Human CD37 features an N-terminal 10xHis tag. This tag enhances its solubility and simplifies downstream applications. With a purity level of greater than 85% as determined by SDS-PAGE, you can trust in the reliability and consistency of this protein for your research. Whether you prefer liquid or lyophilized powder form, we offer both options, providing flexibility in storage and experimental setups. Explore the vast potential of the Recombinant Human CD37 protein in advancing your immunological investigations and gaining deeper insights into immune responses and cell signaling pathways.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Gene References into Functions

CD37 is a critical determinant of rituximab plus cyclophosphamide, doxorubicin, vincristine, and prednisone outcome in diffuse large B-cell lymphoma. PMID:27760757
Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML). PMID:25934707
The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. PMID:24445867
Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen. PMID:23883821
Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals. PMID:22624718
In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity. PMID:20709950
CD37 cross-linking on human T cells transduces signals that lead to complete inhibition of CD3-induced T cell proliferation. PMID:14978098
CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production. PMID:17182550
provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies PMID:17440052