TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Gene References into Functions
our study demonstrates that Flt3L acts as an important regulator of ILCs lymphopoiesis and it can be used as a tool to expand and study ILCs precursors in the BM.PMID:29317685
Results elucidated a novel resistance mechanism that FL attenuated inhibitory effects of FLT3 inhibitors mainly through the activation of Wt-FLT3, not mutated FLT3 in acute myeloid leukemia.PMID:27331411
it is likely that TGFbeta1 and FL, both abundantly produced by bone marrow stromal cells, function in a coordinated manner to render mixed-lineage leukemia gene-rearranged acute lymphoblastic leukemia cells chemoresistantPMID:28917156
serum levels can be a marker of cutaneous manifestation in dermatomyositis and marker of microangiopathy in systemic sclerosisPMID:26559027
Pre-treatment serum levels of FLT3-L were higher than controls. FLT3-L correlated positively with all soluble angiogenic factors, as well with bone marrow microvascular density. Post-treatment FLT3-L decreased significantly in responders to therapy.PMID:26521986
The immunohistochemical expression of caveolin-1 and podocalyxin in lungs from rats challenged with a 2-kDa macrophage-activating lipopeptide (MALP-2) and Flt3L, was examined.PMID:24419512
Flt3L enhances global T cell and humoral immunity as well as both the numbers and antigen capture capacity of migratory dendritic cells and classical lymphoid-resident dendritic cellsPMID:25135299
Human bone marrow stromal cells simultaneously support B and T/NK lineage development from human haematopoietic progenitors: a principal role for flt3 ligand in lymphopoiesis.PMID:22463758
A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation.PMID:22110249
data demonstrate that the Flt3L/TK gene therapeutic approach can induce systemic immunological memory capable of recognizing a brain tumor neoantigen in a model of recurrent GBMPMID:21505426
FLT3 ligand(FL) leads to further activation of FLT3 mutants and is especially important in light of recent findings of elevated FL levels in acute myeloid leukemia patients in response to chemotherapy.PMID:21516120
FLT3 ligand impedes the efficacy of FLT3 inhibitors in vitro and in vivo.PMID:21263155
results demonstrate that hsFlt3L induces the proliferation of canine DCs and support its use in upcoming clinical trials for canine glioblastoma multiformePMID:20552015
Exogenous administration of Flt3 ligand increases the CD11c-expressing dendritic cell population, which, when expressing IL-15, significantly expands mature natural killer (NK) cells via enhanced survival and proliferation.PMID:20142363
Data suggest that Flt3 Ligand(FL) gene regulated by Egr-1 promoter can protect hematopoiesis from 5-Fu injury.PMID:19426596
Treatment with recombinant human FLT3 ligand prevents ovalbumin-induced asthma in the mouse by stimulating IL-12 secretion by dendritic cells. It may provide a useful adjuvant in the treatment of human asthma.PMID:11710537
effect of recombinant human Flt-3 ligand on dendritic cell populations in mouse spleenPMID:11877288
Expression of FLT3L in primary gastrointestinal non-Hodgkin's lymphoma.PMID:11956621
Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells.PMID:12002675
Incubation of acute stem cell leukemia cells with the flt3 ligand induced the expression of unilineage HGF receptors, allowing cell growth without differentiation .PMID:12036900
Flt3L-mobilized DC from cancer patients require a sequence of specific signals for maturation, including initial treatment with granulocyte macrophage-colony stimulating factor followed by a combination of maturation signals such as CD40L and IFN-gamma.PMID:12223523
Administration of Flt3-L enhances a Th1-type response against mouse thyroglobulin by selective expansion of mouse dendritic cell subsets that results in induction of a severe type of murine autoimmune thyroiditis.PMID:12759428
A single dose of recombinant human Flt3L locally applied in the trachea of rats results in a dose-dependent increase of dendritic cells as well as CD4+ and CD8+ T lymphocytes with different responses in lung interstitium and bronchoalveolar space.PMID:12817014
Thrombopoietin cooperates with FLT3-L, inducing CD34+ HPCs to undergo a 400-fold expansion in cell numbers.PMID:14670916
endogenous FLT3LG has distinct effects on the kinetics of reconstitution of DCs and NK ce; speed of recovery of CD11c(+)CD123(low) DC1 exceeded that of CD11c(-) CD123(+) DC2, and correlated with plasma levels of flt3 ligandPMID:14764540
flt3L is a potent immunorestorative agent that enhances both thymic-dependent and thymic-independent pathways of T-cell regenerationPMID:15226184
Increased serum levels of the early hemopoietic cytokine FLT3-L could explain increased numbers of circulating dendritic cells in Langerhans cell histiocytosis.PMID:15728521
Human flt3 ligand-mediated generation and mobilization of naive dendritic cells, fully responsive to infectious stimuli, accelerates recovery from endotoxin tolerance-related immunoparalysis in a murine infection model.PMID:15905588
Purified recombinant FLT3 ligand had dose-dependent expansion activity on bone marrow nucleated cells.PMID:15914030
Addition of Flt3-L to the optimal combination of megakaryocyte (Mk) growth factor MGDF, stem cell factor, interleukin-3, and granulocyte-macrophage colony stimulating factor GM-CSF reduces both fold expansion of Mk progenitors and Mk colony numbers.PMID:16487027
Flt-3L treatment expands conventional & plasmacytoid dendritic cells in vivo, increasing antigen presentation by direct- & cross-presentation. It augments the size of an immune response but requires further adjuvant activation to alter its quality.PMID:17949888
Results indicate that Flt3-L is strongly expressed at the site of inflammation in human rheumatoid arthritis, and it exerts both pro-inflammatory and tissue destructive properties once in the joint cavity.PMID:18982072
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.