Abbreviation
Recombinant Human FLT-3L protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
≤10 EU/mg by the LAL method
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of human OCI-AML5 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg.
Alternative Names
Fms-Felated Tyrosine Kinase 3 Ligand; Flt3 Ligand; Flt3L; SL Cytokine; FLT3LG
Species
Homo sapiens (Human)
Expression Region
27-184aa
Target Protein Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
FLT3 ligand drives the expansion and differentiation of hematopoietic progenitors and dendritic cells, making it a critical tool for studies of myeloid development and immune cell mobilization. This recombinant protein, spanning residues 27–184 of the mature human sequence, demonstrates potent bioactivity with an ED50 ≤ 1.0 ng/ml in OCI-AML5 proliferation assays, corresponding to a specific activity ≥ 1 × 10⁶ units/mg that supports dose-response experiments in primary hematopoietic cultures and dendritic cell differentiation protocols. Endotoxin levels ≤ 10 EU/mg satisfy the stringent criteria expected for immune cell functional assays, where LPS contamination would confound readouts of cytokine-driven activation or JAK/STAT signaling. Produced in mammalian cells to preserve native glycosylation and folding, the protein meets the quality thresholds commonly required for in vivo hematopoiesis models, antibody validation workflows, and reference standards in FLT3L detection assays, with purity exceeding 95% by SDS-PAGE.