Home
Product
Protein
Transmembrane Proteins
Recombinant Human FUN14 domain-containing protein 1 (FUNDC1)

Recombinant Human FUN14 domain-containing protein 1 (FUNDC1)

Code: CSB-CF816886HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3654

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

FUNDC1

Uniprot NO.

Q8IVP5

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-155

Target Protein Sequence

MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.

Gene References into Functions

Our data suggested that FUNDC1 can be used as a prognostic biomarker in patients with cervical cancer, and may be a new therapeutic target to improve the antitumor effects of chemoradiotherapy. PMID:28719148
phosphorylation of Tyr18 of FUNDC1 serves as a molecular switch for mitophagy. PMID:27653272
FUNDC1 integrates mitochondrial fission and mitophagy at the interface of the endoplasmic reticulum-mitochondrial contact site by working in concert with DRP1 and calnexin under hypoxic conditions in mammalian cells. PMID:27145933
FUNDC1 regulates both mitochondrial fission or fusion and mitophagy. PMID:27050458
The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy. PMID:25126723
FUNDC1 regulates ULK1 recruitment to damaged mitochondria, where FUNDC1 phosphorylation by ULK1 is crucial for mitophagy. PMID:24671035
Data show that Knockdown of endogenous FUNDC1 significantly prevented hypoxia-induced mitophagy, which could be reversed by the expression of wild-type FUNDC1. PMID:22267086