Recombinant Human Claudin-9 (CLDN9)

Code: CSB-CF005511HU
Size:
20μg
20μg100μg
US$4118
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CLDN9
Uniprot NO.
Alternative Names
CLDN9; Claudin-9
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-217
Target Protein Sequence
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Gene References into Functions
  1. CLDN9 may be an important biomarker for invasive pituitary oncocytomas. PMID:25281028
  2. Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis. PMID:19960275
  3. Mouse studies suggest that claudin-9 deficiency may cause hearing loss not only in mice but also in humans. PMID:19696885
  4. Residues N38 and V45 in the first extracellular loop (EL1) of CLDN9 are necessary for HCV entry. PMID:17804490
  5. CLDN9, clustered with CLDN6 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID:12736707

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Database Links

HGNC: 2051

UNIGENE: Hs.296949

KEGG: hsa:9080

STRING: 9606.ENSP00000398017

OMIM: 615799

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products