MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
Gene References into Functions
Signaling focal contacts via CD63 were identified to facilitate cell adhesion, migration and mediate extracellular matrix-physical cues to modulate hematopoietic stem cells and progenitor cells function.PMID:28566689
Human CD63-GFP expression was controlled under the rat Sox2 promoter (Sox2/human CD63-GFP), and it was expressed in undifferentiated fetal brains.PMID:29208635
our results identify the CD63-syntenin-1-ALIX complex as a key regulatory component in post-endocytic HPV trafficking.PMID:27578500
CD63 and exosome expression is altered in scleroderma dermal fibroblastsPMID:27443953
CD63 is a critical player in LMP1 exosomal trafficking and LMP1-mediated enhancement of exosome production and may play further roles in limiting downstream LMP1 signaling.PMID:27974566
TIMP1 signaling via CD63 leads to activation of hepatic stellate cells, which create an environment in the liver that increases its susceptibility to pancreatic tumor cells.PMID:27506299
Concentrations of Cd63 were elevated in gingival crevicular fluid of patients with pre-eclampsia.PMID:26988336
CD163(+) TAMs in oral premalignant lesions coexpress CD163 and STAT1, suggesting that the TAMs in oral premalignant lesions possess an M1 phenotype in a Th1-dominated micromilieu.PMID:26242181
Our findings reveal that elevated levels of TIMP-1 impact on neutrophil homeostasis via signaling through CD63.PMID:26001794
These findings indicate that rhTIMP-1 promotes clonogenic expansion and survival in human progenitors via the activation of the CD63/PI3K/pAkt signaling pathwayPMID:26213230
It was shown that treatment of macrophages with anti-CD63 inhibits CCR5-mediated virus infection in a cell type-specific manner, but that no inhibition of CXCR4-tropic viruses occurs.PMID:25658293
TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface.PMID:25033048
Diesel exhaust exposure during exercise induces platelet activation as illustrated by a dose-response increase in the release of CD62P and CD63.PMID:25297946
Data show that CD63 is a crucial player in the regulation of the tumor cell-intrinsic metastatic potential by affecting cell plasticity.PMID:25354204
CD63 tetraspanin is a negative driver of epithelial-to-mesenchymal transition in human melanoma cells.PMID:24940653
these results indicated that high glycosylation of CD63 by RPN2 is implicated in clinical outcomes in breast cancer patientsPMID:24884960
Collectively, these findings indicate that CD63 may support Env-mediated fusion as well as a late (post-integration) step in the HIV-1 replication cycle.PMID:24507450
Data suggest that TIMP1 (tissue inhibitor of metalloproteinase-1) acts as chemoattractant for neural stem cells (NSC); TIMP1 enhances NSC adhesion, migration, and cytoskeletal reorganization; these effects are dependent on CD63/CD29 (integrin beta1).PMID:24635319
Timp1 is assembled in a supramolecular complex containing CD63 and beta1-integrins along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway.PMID:23522389
Antigen-induced p38 MAPK phosphorylation in human basophils essentially contributes to CD63 upregulationPMID:18727065
Loss of CD63 has a similar phenotype to loss of P-selectin itself, thus CD63 is an essential cofactor to P-selectin.PMID:21803846
shRNA knockdown in B lymphoblastoid cell line results to increased CD4(+) T-cell recognitionPMID:21660937
decreased levels of CD63 were associated with distant and lymph node metastasis status and does play a direct role in human gastric carcinogenesis.PMID:21521534
C-terminal modifications that retain LMP1 in Golgi compartments preclude assembly within CD63-enriched domains and/or exosomal discharge leading to NF-kappaB overstimulation.PMID:21527913
These findings suggest that CD63 plays an early post-entry role prior to or at the reverse transcription step.PMID:21315401
ameloblastin is expressed in osteoblasts and functions as a promoting factor for osteogenic differentiation via a novel pathway through the interaction between CD63 and integrin beta1PMID:21149578
Surface expression of the novel CD63 variant is a distinguishing feature of mast cells, which are are stable, multiple-use cells capable of surviving and delivering several consecutive hitsPMID:20337613
this work provides the first evidence of a TIMP-4/CD63 association in astrocytoma tumor cellsPMID:20693981
CD63 expression results from only the anaphylactic degranulation form of histamine release.PMID:20633031
Serum sCD163 is a homogenous protein covering more than 94% of the CD163 ectodomain including the haptoglobin-hemoglobin -binding region.PMID:19581020
Results show that AP-3 is absolutely required for the delivery of CD63 to lysosomes via the trans-Golgi network.PMID:11907283
downregulation of CD63 antigen is associated with breast tumor progressionPMID:12579280
possible role in HIV-1 infections specific for macrophagesPMID:12610138
Post-translational modification of CD63 may be involved in the functional and morphological changes of MHC class II compartments that occur during dendritic cell maturationPMID:12755696
relationships between the expression levels of CD61, CD63, and PAC-1 on the platelet surface and the incidences of acute rejection and tubular necrosis as well as the recovery of graft function after renal transplantationPMID:12826159
Upon platelet interaction with fibrinogen, cholesterol accumulated at the tips of filopodia and at the leading edge of spreading cells; cholesterol-rich raft aggregation was accompanied by concentration of c-Src and CD63 in these cell domainsPMID:12871315
The study on CD63 included its chemistry eg. if it had and O-linked carbohydrate that was digested with O-glycanase.PMID:12974720
CD63 serves as an adaptor protein that links its interaction partners to the endocytic machinery of the cell.PMID:14660791
results suggest that CD9, CD63, CD81, and CD82 could play a role in modulating the interactions between immature DCs and their environment, slowing their migratory ability. However, only CD63 would intervene in the internalization of complex antigensPMID:15130945
Constitutive expression of CD63 may indicate that this factor does not play a direct role in thyroid carcinogenesisPMID:15375577
CD63 represents an activation-induced reinforcing element, whose triggering promotes sustained and efficient T cell activation and expansion.PMID:15528334
The linkage of CD63 with PI 4-kinase may result in the recruitment of this signaling enzyme to specific membrane locations in the platelet where it influences phosphoinositide-dependent signaling and platelet spreading.PMID:15711748
This study identifies a trafficking pathway from CD63-positive multivesicular bodies to the bacterial inclusion, a novel interaction that provides essential lipids necessary for maintenance of a productive intracellular infection.PMID:16410552
CD63 is recruited to already-budded Weibel-Palade bodies by an AP-3-dependent routePMID:16683915
CD63-syntenin-1 complex is abundant on the plasma membranePMID:16908530
CD63 is a cell surface binding partner for TIMP-1, regulating cell survival and polarization via TIMP-1 modulation of tetraspanin/integrin signaling complex.PMID:16917503
Chronic urticaria serum-induced CD63 expression assay performed on atopic whole blood by means of tricolor flow cytometry could be the most useful tool for identification of a subset of patients with autoimmune chronic urticaria.PMID:16918509
In conclusion, using well-defined experimental conditions, the measurement of CD203c up-regulation on basophils in response to specific allergens is as reliable as CD63-BAT for the in vitro diagnosis of patients with IgE-mediated allergy.PMID:17275019
positive correlation between CD63 and erythrocyte sedimentation rate in rheumatoid arthritisPMID:17279322
Results suggest that CD63 can be a biomarker for predicting the prognosis in early stages of lung adenocarcinoma.PMID:17350713