ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Gene References into Functions
CD79B mutations were found in six of 19 cases (31.6%) of primary CNS diffuse large B-cell lymphoma , all in the Y196 mutation hotspotPMID:28856744
Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of CD79B mutations.PMID:28803429
hotspot mutations of CD79B Y196 and MYD88 L265 may serve as a genetic hallmark for primary central nervous system lymphomaPMID:26111727
CD79B overexpression leading to activation of AKT/MAPK is a potential mechanism underlying primary ibrutinib resistance in ABC-DLBCL, and support its utility as an effective biomarker to predict therapeutic response to ibrutinib.PMID:26699656
Novel CD79B variations in mature B-cell non-Hodgkin's lymphoma patients were detected.PMID:27010137
MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma.PMID:26752547
Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system.PMID:25347427
Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations.PMID:25501023
Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies.PMID:25414443
results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTLPMID:24253023
CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease.PMID:24444466
CD79B point mutation is associated with B-cell non-Hodgkin lymphomas.PMID:23361872
Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription.PMID:23649625
The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma.PMID:22808296
Expression of CD79b is downregulated in both plasma cells and plasma cell myeloma.PMID:21355953
The B cell-specific B29 gene promoter is transactivated in B and non-B cells by cotransfection with the B cell-specific octamer cofactor gene, Bob1 (OCA-B/OBF-1).PMID:11907094
The alternative splicing variant DeltaCD79b may be a powerful modulator of BCR signaling that may play an important role in normal and malignant B cellPMID:12384401
Following B cell receptor cross-linking, a significant amount of the transgenic Ig beta pool (together with Ig alpha) remains on the B cell surface independent of surface immunoglobulin internalization.PMID:15661909
Results reveal tissue-specific patterns of chromatin structures and transcriptional controls at the CD79b/GH locus in B cells distinct from those in the pituitary gland and placenta.PMID:16847312
establish a strong linkage between Igbeta mRNA expression and somatic hypermutation in chronic lymphocytic leukaemia and highlight the complex relationships between biochemical parameters and clinical status in this diseasePMID:17315213
Ig-beta was phosphorylated in about 20% of myeloma IgG BCR isolates, but not in normal B-cell controls.PMID:17701175
These results indicate that mutations in Igbeta can cause agammaglobulinemia in man.PMID:17709424
mutations responsible for agammaglobulinemia in humansPMID:18978465
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.