Abbreviation
Recombinant Human CD79B protein, partial (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 3.214-3.642 ng/mL.
Alternative Names
B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD antigen CD79b
Species
Homo sapiens (Human)
Expression Region
29-159aa
Target Protein Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 3.214-3.642 ng/mL.
Description
CD79B forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain reagents essential for antibody development pipelines. This mammalian-expressed protein spanning residues 29–159 demonstrates quantifiable antibody-binding activity with an EC50 of 3.214–3.642 ng/mL in functional ELISA, providing a validated basis for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening campaigns. The mammalian expression system supports native glycosylation and disulfide bond formation critical for conformational epitope presentation, enabling this protein to serve as a positive control in SPR and BLI affinity characterization experiments where authentic receptor structure is required. With greater than 90% purity and endotoxin levels below 1.0 EU/μg, this reagent meets the quality thresholds commonly required for ligand-binding studies and small-molecule inhibitor screening in B-cell immunology research.
