Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B),partial (Active)

CSB-MP004958HU1
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 3.214-3.642 ng/mL.
Target Names
CD79B
Uniprot NO.
Alternative Names
B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD antigen CD79b
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-159aa
Target Protein Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Mol. Weight
16.7kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 3.214-3.642 ng/mL.
Description

The human CD79B, amino acids Asp159-Arg143 with a C-terminal 10xHis-tag was co-expressed and purified as a human CD79B protein. The endotoxin of this recombinant human CD79B protein is less than 1.0 EU/ug as determined by the LAL method. This recombinant CD79B protein has been validated to be biologically active through a functional ELISA where it binds the anti-CD79B recombinant antibody (CSB-RA004958MA2HU), with the EC50 of 3.214-3.642 ng/mL.

The human CD79B protein is a crucial component of the B-cell receptor (BCR) complex, which plays a significant role in B-cell development and function. CD79B, along with its counterpart CD79A, forms a disulfide-linked heterodimer that associates with membrane immunoglobulin (mIg) to facilitate antigen recognition and signal transduction in B cells [1]. CD79B is primarily expressed on the surface of mature B cells and is absent in plasma cells, making it a valuable marker for identifying B-cell malignancies such as non-Hodgkin lymphoma (NHL) and chronic lymphocytic leukemia (CLL) [2].

CD79B mainly transduces signals following antigen binding to the BCR. This signaling is essential for various B-cell activities, including differentiation, activation, and proliferation [3]. The BCR signaling pathway, which relies on CD79B, is critical for the formation of immune synapses and the regulation of B-cell migration [4]. Notably, aberrations in CD79B expression or function can lead to dysregulated BCR signaling, which is associated with immunosuppression in the tumor microenvironment [4].

Research has shown that mutations in the CD79B gene can impact its function and expression. Specific mutations in the immunoreceptor tyrosine-based activation motif (ITAM) of CD79B can lead to altered signaling capabilities, potentially contributing to the pathogenesis of B-cell lymphomas [5]. Additionally, the expression levels of CD79B can vary significantly among different B-cell malignancies, which has implications for therapeutic targeting using antibody-drug conjugates (ADCs) [6][7]. These ADCs are designed to selectively target CD79B on malignant B cells, thereby enhancing the efficacy of treatment while minimizing damage to normal cells [2].

The downregulation of CD79B has been observed in various hematological malignancies, suggesting that its expression is tightly controlled and can be disrupted in pathological conditions [8][9]. Understanding the regulatory mechanisms governing CD79B expression and function is critical for developing targeted therapies and improving patient outcomes in B-cell-related diseases.

References:
[1] L. Duncan, K. Webster, V. Gupta, S. Nair, & E. Deane. Molecular characterisation of the cd79a and cd79b subunits of the b cell receptor complex in the gray short-tailed opossum (monodelphis domestica) and tammar wallaby (macropus eugenii): delayed b cell immunocompetence in marsupial neonates, Veterinary Immunology and Immunopathology, vol. 136, no. 3-4, p. 235-247, 2010. https://doi.org/10.1016/j.vetimm.2010.03.013
[2] A. Herrera, M. Patel, J. Burke, R. Advani, B. Cheson, J. Sharman, et al. Anti-cd79b antibody–drug conjugate dcds0780a in patients with b-cell non-hodgkin lymphoma: phase 1 dose-escalation study, Clinical Cancer Research, vol. 28, no. 7, p. 1294-1301, 2022. https://doi.org/10.1158/1078-0432.ccr-21-3261
[3] D. Pu, D. Liú, C. Li, C. Chen, Y. Che, J. Lv, et al. A novel ten-gene prognostic signature for cervical cancer based on cd79b-related immunomodulators, Frontiers in Genetics, vol. 13, 2022. https://doi.org/10.3389/fgene.2022.933798
[4] Y. Wang, Y. Yang, Z. Zhao, H. Sun, D. Luo, L. Huttad, et al. A new nomogram model for prognosis of hepatocellular carcinoma based on novel gene signature that regulates cross-talk between immune and tumor cells, BMC Cancer, vol. 22, no. 1, 2022. https://doi.org/10.1186/s12885-022-09465-9
[5] B. Kloo, D. Nagel, M. Pfeifer, M. Grau, M. Düwel, M. Vincendeau, et al. Critical role of pi3k signaling for nf-κb–dependent survival in a subset of activated b-cell–like diffuse large b-cell lymphoma cells, Proceedings of the National Academy of Sciences, vol. 108, no. 1, p. 272-277, 2010. https://doi.org/10.1073/pnas.1008969108
[6] A. Polson, J. Calemine-Fenaux, P. Chan, W. Chang, E. Christensen, S. Clark, et al. Antibody-drug conjugates for the treatment of non–hodgkin's lymphoma: target and linker-drug selection, Cancer Research, vol. 69, no. 6, p. 2358-2364, 2009. https://doi.org/10.1158/0008-5472.can-08-2250
[7] M. Pfeifer, B. Zheng, T. Erdmann, H. Koeppen, R. McCord, M. Grau, et al. Anti-cd22 and anti-cd79b antibody drug conjugates are active in different molecular diffuse large b-cell lymphoma subtypes, Leukemia, vol. 29, no. 7, p. 1578-1586, 2015. https://doi.org/10.1038/leu.2015.48
[8] X. Huang, K. Takata, Y. Sato, T. Tanaka, K. Ichimura, M. Tamura, et al. Downregulation of the b‐cell receptor signaling component cd79b in plasma cell myeloma: a possible post transcriptional regulation, Pathology International, vol. 61, no. 3, p. 122-129, 2011. https://doi.org/10.1111/j.1440-1827.2010.02634.x
[9] D. Jovanovic, P. Djurdjevic, N. Andjelkovic, & L. Zivic. Possible role of cd22, cd79b and cd20 expression in distinguishing small lymphocytic lymphoma from chronic lymphocytic leukemia, Współczesna Onkologia, vol. 1, p. 29-33, 2014. https://doi.org/10.5114/wo.2013.38570

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Gene References into Functions
  1. CD79B mutations were found in six of 19 cases (31.6%) of primary CNS diffuse large B-cell lymphoma , all in the Y196 mutation hotspot PMID:28856744
  2. Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of CD79B mutations. PMID:28803429
  3. hotspot mutations of CD79B Y196 and MYD88 L265 may serve as a genetic hallmark for primary central nervous system lymphoma PMID:26111727
  4. CD79B overexpression leading to activation of AKT/MAPK is a potential mechanism underlying primary ibrutinib resistance in ABC-DLBCL, and support its utility as an effective biomarker to predict therapeutic response to ibrutinib. PMID:26699656
  5. Novel CD79B variations in mature B-cell non-Hodgkin's lymphoma patients were detected. PMID:27010137
  6. MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma. PMID:26752547
  7. Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system. PMID:25347427
  8. Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations. PMID:25501023
  9. Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies. PMID:25414443
  10. results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL PMID:24253023
  11. CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease. PMID:24444466
  12. CD79B point mutation is associated with B-cell non-Hodgkin lymphomas. PMID:23361872
  13. Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription. PMID:23649625
  14. The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma. PMID:22808296
  15. Expression of CD79b is downregulated in both plasma cells and plasma cell myeloma. PMID:21355953
  16. The B cell-specific B29 gene promoter is transactivated in B and non-B cells by cotransfection with the B cell-specific octamer cofactor gene, Bob1 (OCA-B/OBF-1). PMID:11907094
  17. The alternative splicing variant DeltaCD79b may be a powerful modulator of BCR signaling that may play an important role in normal and malignant B cell PMID:12384401
  18. Following B cell receptor cross-linking, a significant amount of the transgenic Ig beta pool (together with Ig alpha) remains on the B cell surface independent of surface immunoglobulin internalization. PMID:15661909
  19. Results reveal tissue-specific patterns of chromatin structures and transcriptional controls at the CD79b/GH locus in B cells distinct from those in the pituitary gland and placenta. PMID:16847312
  20. establish a strong linkage between Igbeta mRNA expression and somatic hypermutation in chronic lymphocytic leukaemia and highlight the complex relationships between biochemical parameters and clinical status in this disease PMID:17315213
  21. Ig-beta was phosphorylated in about 20% of myeloma IgG BCR isolates, but not in normal B-cell controls. PMID:17701175
  22. These results indicate that mutations in Igbeta can cause agammaglobulinemia in man. PMID:17709424
  23. mutations responsible for agammaglobulinemia in humans PMID:18978465

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1699

UNIGENE: Hs.89575

KEGG: hsa:974

STRING: 9606.ENSP00000376544

OMIM: 147245

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products