Abbreviation
Recombinant Human CD79B protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 31.97-35.69 ng/mL.
Alternative Names
B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD antigen CD79b
Species
Homo sapiens (Human)
Expression Region
29-159aa
Target Protein Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-mFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 31.97-35.69 ng/mL.
Description
CD79B forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This construct spans residues 29–159 and demonstrates quantifiable antibody-binding activity with an EC50 of 31.97–35.69 ng/mL in functional ELISA, providing a suitable basis for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression preserves the native glycosylation and disulfide architecture required for physiologically relevant receptor-antibody interactions in surface plasmon resonance, biolayer interferometry, and affinity characterization experiments. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for drug discovery campaigns targeting B-cell surface receptors and for use as a positive control in binding assays evaluating anti-CD79B biologics.