LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status.PMID:27915469
Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part.PMID:24769851
High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase.PMID:24974109
CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy.PMID:24146823
STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL.PMID:21324920
CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphomaPMID:20102401
Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1.PMID:11907094
B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review.PMID:12403343
There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma.PMID:12651942
Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis.PMID:15492262
lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains.PMID:15591116
FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage.PMID:16271957
Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia.PMID:17350472
Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma.PMID:17374736
Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells.PMID:17701175
Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia.PMID:18160827
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.