Abbreviation
Recombinant Human CD79A protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 14.44-16.80 ng/mL.
Alternative Names
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
Species
Homo sapiens (Human)
Expression Region
33-143aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal mFc-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 14.44-16.80 ng/mL.
Description
CD79A forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This construct spans residues 33–143 and demonstrates quantifiable binding to an anti-CD79A recombinant antibody with an EC50 of 14.44–16.80 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation. Mammalian expression preserves the native glycosylation and disulfide bond architecture critical for conformational epitope presentation, supporting affinity characterization by surface plasmon resonance or biolayer interferometry where authentic folding directly impacts KD measurements. The protein meets quality thresholds commonly required for ligand-binding assays and drug discovery applications, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, satisfying criteria typical for cell-based functional studies where low endotoxin is essential to avoid B-cell activation artifacts.
