Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

In Stock
Code: CSB-MP004957HU1p6
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal mFc-Flag-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CD79A protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 14.44-16.80 ng/mL.
Target Names
CD79A
Uniprot NO.
Alternative Names
B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-143aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.3 kDa
Protein Length
Partial
Tag Info
C-terminal mFc-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 14.44-16.80 ng/mL.
Description

CD79A forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This construct spans residues 33–143 and demonstrates quantifiable binding to an anti-CD79A recombinant antibody with an EC50 of 14.44–16.80 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation. Mammalian expression preserves the native glycosylation and disulfide bond architecture critical for conformational epitope presentation, supporting affinity characterization by surface plasmon resonance or biolayer interferometry where authentic folding directly impacts KD measurements. The protein meets quality thresholds commonly required for ligand-binding assays and drug discovery applications, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, satisfying criteria typical for cell-based functional studies where low endotoxin is essential to avoid B-cell activation artifacts.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
Gene References into Functions
  1. The incidence of MYD88 and CD79B mutations in patients with CD5(+) DLBCL is lower than that in patients with DLBCL-SS, suggesting that CD5(+) DLBCL is not the same disease as DLBCL-SS in terms of gene mutation status. PMID:27915469
  2. Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part. PMID:24769851
  3. High intensity of caries is associated with increased levels of some salivary components - sIgA, histatin-5 and lactoperoxidase. PMID:24974109
  4. CD79a plays a functional role in the tumor promoting effects of myeloid cells, and may represent a novel target for cancer therapy. PMID:24146823
  5. STN produced significant antitumor effects in a mouse xenograft model of CD79A/B-mutated DLBCL. PMID:21324920
  6. CD79a may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID:20102401
  7. Unlike the B29 octamer motif, the mb-1 octamer motif does not have the essential sequence required for OBF-1/Bob1 interaction, therefore its promoter is not transactivated by OBF-1/Bob1. PMID:11907094
  8. B cell-restricted mb-1 gene: expression, function, and lineage infidelity. Review. PMID:12403343
  9. There is a somatic hypermutation of this gene in B-cell lymphoma and multiple myeloma. PMID:12651942
  10. Results indicate that PAX5 is a more specific marker than CD79a for B-cell ALL diagnosis. PMID:15492262
  11. lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains. PMID:15591116
  12. FISH findings indicate that CD79a, despite its specificity for B-cell differentiation, represented the aberrant presence of a B-cell antigen in leukemias of distinct myeloid linage. PMID:16271957
  13. Acute leukemia with t(8;21) coexpresses CytCD79a represent biphenotypic acute leukemia. PMID:17350472
  14. Anti-CD79b antibodies downregulated surface B-cell receptor and were trafficked to the lysosomal-like major histocompatibility complex class II-positive compartment of a mouse xenograft model of non-Hodgkin lymphoma. PMID:17374736
  15. Ig-alpha was phosphorylated in all myeloma IgG BCR isolates, the 31-kD variant being phosphorylated most frequently. It was not phosphorylated in normal control B cells. PMID:17701175
  16. Median survival time of cytoplasmic CD79 alpha positive group was shorter than that of cytCD79a negative group in acute myeloid leukemia. PMID:18160827

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1698

UNIGENE: Hs.631567

KEGG: hsa:973

STRING: 9606.ENSP00000221972

OMIM: 112205

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products